ESTScan Details for Unigene SGN-U596219

Score 
247
Direction 
Forward
Predicted Peptide Sequence 
EQRTVYRLTLVKGWNTEDVDAYSSLFSIGKPDFIEIKGVTYCGTSATSKLTMENVPWHSDVKEFSEALAKKSNGEYEVACEQCIPAXVLL
AKVHKFKIDGQWVTWIDYQKFHXSGNFWETPYQ*
Predicted Coding Sequence 
GAGCAAAGAACTGTCTATCGTTTGACACTCGTTAAAGGGTGGAACACAGAAGATGTGGATGCATATTCTAGCCTATTCAGCATTGGGAAA
CCCGATTTCATTGAAATCAAAGGTGTCACTTATTGTGGAACGTCGGCTACATCAAAGTTGACAATGGAGAATGTCCCTTGGCATTCTGAT
GTGAAGGAATTCTCTGAAGCCTTGGCTAAAAAGAGCAACGGAGAGTATGAAGTTGCCTGTGAGCAGTGCATTCCTGCTGXTGTTCTTCTG
GCTAAAGTCCATAAGTTCAAAATAGACGGGCAATGGGTCACGTGGATAGACTACCAAAAATTCCATGXATCTGGTAACTTCTGGGAAACC
CCTTACCAGTAA
Edits in Original Sequence 
(5')GAGCAAAGAACTGTCTATCGTTTGACACTCGTTAAAGGGTGGAACACAGAAGATGTGGATGCATATTCTAGCCTATTCAGCATTGG
GAAACCCGATTTCATTGAAATCAAAGGTGTCACTTATTGTGGAACGTCGGCTACATCAAAGTTGACAATGGAGAATGTCCCTTGGCATTC
TGATGTGAAGGAATTCTCTGAAGCCTTGGCTAAAAAGAGCAACGGAGAGTATGAAGTTGCCTGTGAGCAcGTGCATTCCTGCTGXTGTTC
TTCTGGCTAAAGTCCATAAGTTCAAAATAGACGGGCAATGGGTCACGTGGATAGACTACCAAAAATTCCATGXATCTGGTAACTTCTGGG
AAACCCCTTACCAGTAA(3')AGAATACCTGACACCCACCCCATCTTGGGCTGGCTATTGAACTGAAGAAAGGGGGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan