Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U596860

Score 
5
Direction 
Forward
Predicted Peptide Sequence 
XGYHSYDLIYADREHLEFVIKTDYXNDRKPMEDHLKEHAKRFIEFRERRGLIEKDVVRTDKLDSFYEEDDNPNINCLRDILLTYSFYNFD
LGYCQGMSDLLSPIFVYMGDX
Predicted Coding Sequence 
XXGGGATACCATTCATATGATTTAATTTATGCAGATAGGGAACACCTTGAGTTCGTCATAAAGACAGATTATXTAAACGATAGAAAACCA
ATGGAAGATCATCTCAAGGAGCATGCAAAAAGATTTATAGAATTCCGAGAGAGGAGAGGCCTCATTGAAAAAGATGTGGTGAGGACTGAT
AAGTTAGATTCATTCTATGAAGAGGATGACAACCCAAACATTAATTGTTTGCGTGATATACTGCTGACATACTCATTCTACAACTTTGAT
TTGGGTTACTGTCAGGGTATGAGCGATCTTCTTTCACCAATATTTGTTTATATGGGAGATGAX
Edits in Original Sequence 
(5')XXGGGATACCATTCATATGATTTAATTTATGCAGATAGGGAACACCTTGAGTTCGTCATAAAGACAGATTATXTAAACGATAGAAA
ACCAATGGAAGATCATCTCtAAGGAGCATGCAAAAAGATTTATAGAATTCCGAGAGAGGAGAGGCCTCATTGAAAAAGATGTGGTGAGGA
CTGATAAGTTAGATTCATTCTATGAAGAGGATGACAACCCAAACATTAATTGTTTGCGTGATATACTGCTGACATACTCATTCTACAACT
TTGATTTGGGTTACTGTCAGGGTATGAGCGATCTTCTTTCACCAATATTTGTTTAtTATGGGAGATGAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan