ESTScan Details for Unigene SGN-U597365

Score 
395
Direction 
Forward
Predicted Peptide Sequence 
AQDEIEDLSLSLPTVGSMQIAGSNGFGHNIEFMSQAYLRNRSSEIDIEVEHDTSIAHIDQPLPIFLKFANVEYKVKTNQAFSNNPVKAVV
SKVASQFENDNYKHILKGITGSISPGEILALMGPSGSGKTTLLKILGGRLHENVKGTVTYNDIPYSPALKRRVGFVTQDDVLFPQLTVEE
TLVFAAFLRLPCKMSRRQKYERVEVIIKELGLESTLXSFHVLEYSLIATTVATVHS*
Predicted Coding Sequence 
GCACAAGATGAAATCGAGGACTTGTCGTTGTCCCTTCCAACTGTTGGCTCAATGCAGATTGCTGGAAGTAACGGTTTTGGACATAACATA
GAGTTCATGTCTCAAGCTTATCTTAGAAACAGAAGCTCTGAAATTGATATAGAAGTTGAACATGATACGTCTATCGCTCATATAGATCAA
CCTCTTCCCATATTCCTCAAGTTTGCAAATGTGGAGTATAAGGTGAAGACTAATCAAGCTTTCTCCAACAATCCTGTCAAGGCAGTTGTC
TCAAAGGTAGCTTCTCAGTTTGAAAATGATAATTACAAACATATACTCAAAGGTATAACGGGAAGCATTAGTCCCGGTGAAATTCTTGCC
TTAATGGGACCTTCGGGCAGTGGAAAAACGACTTTGTTAAAGATACTGGGTGGAAGATTGCACGAAAATGTCAAAGGAACCGTCACTTAC
AATGACATTCCATATAGTCCAGCTCTGAAAAGAAGGGTGGGTTTCGTGACACAAGATGATGTGCTTTTCCCACAATTGACGGTTGAGGAA
ACTTTAGTTTTTGCTGCATTCTTAAGACTTCCATGCAAGATGAGTCGACGTCAGAAGTATGAAAGAGTAGAAGTGATTATTAAGGAATTA
GGCCTTGAAAGTACTTTGNTATCCTTTCATGTACTTGAGTACTCACTAATAGCAACTACCGTTGCAACTGTTCACTCGTGA
Edits in Original Sequence 
(5')GCACAAGATGAAATCGAGGACTTGTCGTTGTCCCTTCCAACTGTTGGCTCAATGCAGATTGCTGGAAGTAACGGTTTTGGACATAA
CATAGAGTTCATGTCTCAAGCTTATCTTAGAAACAGAAGCTCTGAAATTGATATAGAAGTTGAACATGATACGTCTATCGCTCATATAGA
TCAACCTCTTCCCATATTCCTCAAGTTTGCAAATGTGGAGTATAAGGTGAAGACTAATCAAGCTTTCTCCAACAATCCTGTCAAGGCAGT
TGTCTCAAAGGTAGCTTCTCAGTTTGAAAATGATAATTACAAACATATACTCAAAGGTATAACGGGAAGCATTAGTCCCGGTGAAATTCT
TGCCTTAATGGGACCTTCGGGCAGTGGAAAAACGACTTTGTTAAAGATACTGGGTGGAAGATTGCACGAAAATGTCAAAGGAACCGTCAC
TTACAATGACATTCCATATAGTCCAGCTCTGAAAAGAAGGGTGGGTTTCGTGACACAAGATGATGTGCTTTTCCCACAATTGACGGTTGA
GGAAACTTTAGTTTTTGCTGCATTCTTAAGACTTCCATGCAAGATGAGTCGACGTCAGAAGTATGAAAGAGTAGAAGTGATTATTAAGGA
ATTAGGCCTTGAAAGTACTTTGNTATCCTTTCATGTACTTGAGTACTCACTAATAGCAACTACCGTTGCAACTGTTCACTCGTGA(3')A
TTTCTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan