ESTScan Details for Unigene SGN-U597433

Score 
102
Direction 
Forward
Predicted Peptide Sequence 
MVSADFPLFIPARDACYMQSEITPLPPSPPPFSFDTKIKINPPTAIILVTLISVFFAMGIVSVYVRQCADRRFIGDFELADEDSGHAALD
RXGLDPVVITSFPMFFYSDVKHHKIGKSVLECAICLNEFEDAEALRLLPKCSHVFHPNCIDAW
Predicted Coding Sequence 
ATGGTTTCTGCTGATTTCCCTTTGTTTATTCCTGCTCGCGATGCATGTTATATGCAATCAGAAATAACACCATTACCACCATCACCACCA
CCATTTTCATTTGATACGAAAATAAAAATCAACCCACCTACGGCTATCATTTTAGTTACACTTATCAGTGTTTTCTTCGCTATGGGAATT
GTTTCAGTCTACGTCCGTCAATGCGCCGACCGCCGCTTCATCGGCGACTTCGAATTAGCAGACGAAGATTCTGGACACGCGGCGCTCGAT
CGCXATGGACTAGACCCAGTCGTAATTACCTCTTTCCCTATGTTTTTTTACTCTGATGTTAAACATCACAAAATTGGGAAATCAGTGTTA
GAATGTGCAATTTGTTTAAACGAATTCGAAGATGCTGAAGCTCTTCGACTTCTTCCTAAATGCTCTCATGTTTTTCATCCAAATTGCATC
GACGCTTGG
Edits in Original Sequence 
GTACTTGTCCATCATTTATTTGATTGTTTTTTTTTTCTAATGAAGATGATAATCGAGCTAAGCC(5')ATGGTTTCTGCTcGATTTCCCT
TTGTTTATTCCTGCTCGCGATGCATGTTATATcGCAATCAGAAATAACACCATTACCACCATCACCACCACCATTTTCATTTGATACGAA
AATAAAAATCAACCCACCTACGGCTATCATTTTAGTTACACTTATCAGTGTTTTCTTCGCTATGGGAATTGTTTCAGTCTACGTCCGTCA
ATGCGCCGACCGCCGCTTCATCGGCGACTTCGAATTAGCAGACGAAGATTCTGGACgACGCGGCGCTCGATCGCXATGGACTAGACCCAG
TCGTAATTACCTCTTTCCCTATGTTTTTTTACTCTGATGTTAAACATCACAAAATTGGGAAATCAGTGTTAGAATGTGCAATTTGTTTAA
ACGAATTCGAAGATGCTGAAGCTCTTCGACTTCTTCCTAAATGCTCTCATGTTTTTCATCCAAATTGCATCGACGCTTGG(3')TTATTT
TCTCATATTACCTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan