ESTScan Details for Unigene SGN-U597899

Score 
296
Direction 
Forward
Predicted Peptide Sequence 
XFGILANTEHYIYMVKLLGMEGQLREAYELVQSLQEPIDSGIWGALLSCCDAHRNYELADIVACRLFGNKLENSSYRIMLSNMYASDGRW
DLVNKLRVDSEITKLKLPGKSWITSKXNIPLKGTLEVSSVTSFTELTVAESGSEAVRGGGIDLIVLSQRECYHVIPXTNGKEDEFDSFCT
QLK*
Predicted Coding Sequence 
XGCTTTGGCATCTTAGCTAACACTGAACATTATATTTACATGGTAAAGCTTCTTGGAATGGAAGGACAATTAAGAGAAGCTTATGAACTT
GTTCAGTCACTGCAAGAACCAATTGACTCCGGCATTTGGGGAGCACTATTATCATGCTGTGATGCTCATCGAAATTATGAGTTGGCAGAT
ATTGTAGCTTGTCGTCTTTTTGGGAATAAGCTAGAGAATAGTAGTTACAGAATTATGCTTTCAAATATGTATGCTAGTGATGGGAGGTGG
GATTTGGTAAATAAGTTGAGAGTAGATTCTGAGATAACAAAGTTGAAACTTCCTGGAAAAAGCTGGATTACTAGTAAAAAXAACATTCCT
TTGAAAGGAACTCTTGAGGTGTCTTCTGTGACATCTTTCACXGAGTTAACAGTTGCTGAATCTGGATCAGAAGCTGTGAGAGGAGGTGGG
ATCGATCTAATTGTCTTGTCACAAAGGGAATGTTATCATGTAATTCCAXTAACAAATGGAAAAGAAGATGAGTTTGACTCATTCTGCACT
CAACTTAAATGA
Edits in Original Sequence 
(5')XGCTTTGGCATCTTAGCTAACACTGAACATTATATTTACATGGTAAAGCTTCTTGGAATGGAAGGACAATTAAGAGAAGCTTATGA
ACTTGTTCAGTCACTGCAAGAACCAATTGACTCCGGCATTTGGGGAGCACTATTATCATGCTGTGATGCTCATCGAAATTATGAGTTGGC
AGATATTGTAGCTTGTCGTCTTTTTGGGAATAAGCTAGAGAATAGTAGTTACAGAATTATGCTTTCAAATATGTATGCTAGTGATGGGAG
GTGGGATTTGGTAAATAAGTTGAGAGTAGATTCTGAGATAACAAAGTTGAAACTTCCTGGAAAAAGCTGGATTACTAGTAAAAAXAACAT
TCCTTTGAAAGGAACTCTTGAGGTGTCTTCTGTGACATCTTTCACXGAGTTAACAGTTGCTGAATCTaGGATCAGAAGCTGTGAGAGGAG
GTGGGATCGATCTAATTGTCTTGTCACAAAGGGAATGTTATCATGTAATTCCAXTAACAAATGGAAAAGAAGATGAGTTTGACTCATTCT
GCACTCAACTTAAATGA(3')TTCTAANCAGTAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan