ESTScan Details for Unigene SGN-U598672

Score 
403
Direction 
Forward
Predicted Peptide Sequence 
XSETLSENVEQYDLVALDNQVAFDLDELLKASAFVLGKSGIGIVYKVVLEDGLNLAVRRLGEGGSQRFKEFQTEVEAIGKLRHQNIVTLR
AYYWSVDEKLLIYDFIPNGNLTTAIHGKPGMVSFTPLSWSIRLKIMKGTAKGLVYLHEYSPKKYVHGDLKPSNILLGHDMEPKISDFGLG
RLANIAGTSPTLQSNHMTSEKPQQSKQGSAPS
Predicted Coding Sequence 
XGGTCAGAGACGTTATCGGAAAATGTTGAACAATATGATCTAGTGGCACTAGATAATCAAGTGGCATTTGATCTTGATGAACTTCTCAAG
GCATCTGCATTTGTCCTTGGTAAAAGTGGTATCGGCATTGTGTACAAAGTTGTGCTCGAAGACGGGCTTAACTTGGCTGTAAGGAGATTA
GGCGAGGGTGGTTCACAAAGATTTAAGGAATTCCAGACGGAGGTCGAAGCAATTGGAAAACTGAGACATCAAAATATTGTGACTCTTCGT
GCCTATTATTGGTCTGTCGATGAGAAGCTACTGATATATGACTTCATTCCAAATGGAAACCTTACCACTGCAATTCACGGAAAACCTGGT
ATGGTGTCGTTTACACCGCTTTCATGGTCCATTCGACTGAAAATAATGAAGGGAACTGCAAAAGGTTTGGTTTATTTACATGAGTACAGT
CCCAAGAAATATGTTCACGGCGATCTAAAGCCTTCTAATATATTACTTGGGCACGACATGGAGCCCAAAATCTCGGACTTTGGACTTGGA
CGTCTTGCTAATATAGCTGGAACATCCCCTACGTTGCAATCCAACCACATGACCTCTGAGAAACCACAACAAAGTAAGCAAGGCAGTGCG
CCATCX
Edits in Original Sequence 
(5')XGGTCAGAGACGTTATCGGAAAATGTTGAACAATATGATCTAGTGGCACTAGATAATCAAGTGGCATTTGATCTTGATGAACTTCT
CAAGGCATCTGCATTTGTCCTTGGTAAAAGTGGTATCGGCATTGTGTACAAAGTTGTGCTCGAAGACGGGCTTAACTTGGCTGTAAGGAG
ATTAGGCGAGGGTGGTTCACAAAGATTTAAGGAATTCCAGACGGAGGTCGAAGCAATTGGAAAACTGAGACATCAAAATATTGTGACTCT
TCGTGCCTATTATTGGTCTGTCGATGAGAAGCTACTGATATATGACTTCATTCCAAATGGAAACCTTACCACTGCAATTCACGGAAAACC
TGGTATGGTGTCGTTTACACCGCTTTCATGGTCCATTCGACTGAAAATAATGAAGGGAACTGCAAAAGGTTTGGTTTATTTACATGAGTA
CAGTCCCAAGAAATATGTTCACGGCGATCTAAAGCCTTCTAATATATTACTTGGGCACGACATGGAGCCCAAAATCTCGGACTTTGGACT
TGGACGTCTTGCTAATATAGCTGGAACATCCCCTACGTTGCAATCCAACCACATGACCTCTGAGAAACCACAACAAAGTAAGCAAGGCAG
TGCGCCATCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan