ESTScan Details for Unigene SGN-U598746

Score 
55
Direction 
Reverse
Predicted Peptide Sequence 
MEYVGPAYHWQAKATKVVWRSVSVDHTVSYR*
Predicted Coding Sequence 
ATGGAGTACGTTGGACCGGCATATCATTGGCAGGCCAAAGCAACAAAAGTCGTATGGAGATCAGTGTCCGTTGATCACACTGTAAGTTAC
CGGTAA
Edits in Original Sequence 
GACAAAGCAAGATTTTGATATAATCATTGAAGCCTCTAAAAGAAATAAACAGTAGTCACTTTTTCATACCAAATGGAGTAAGTCGAGTTT
TGATTATCAAATACTATGCAAATTCTACAACAAATTCATCCTAACAACAAAAACTCAAAAACGTAAAGAAAAACTTTAAACCAAAACAAG
AATGCCAAACAAAATTGACTTAGCTCTGTTTTGTTGCC
(5')ATGGAGTACGTTGGACCGGCATATCATTGGCAGGCCAAAGCAACAAAA
GTCGTATGGAGATCAGTGTCgCGTTGATCACACTGTAAGTTACCGGTAA(3')AAGTAAATTACTGTTTCTCTTTCTTTGCTAAGGATTC
TC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan