ESTScan Details for Unigene SGN-U598987

Score 
-13
Direction 
Forward
Predicted Peptide Sequence 
NLGVQALVCCSRKDAGNEDWHPATVDPVDHFRVNW*
Predicted Coding Sequence 
AATCTTGGCGTCCAAGCTCTTGTTTGCTGCTCTCGAAAAGACGCAGGTAACGAGGATTGGCATCCAGCCACCGTTGATCCAGTTGATCAC
TTCAGAGTCAATTGGTGA
Edits in Original Sequence 
TTCTTTGCTGAGATTTGTGTTTCCACGAATTCAAATTTTGAATTCTTGGAGCCCAAATTGACTATAAGAAGGGGAGGCAGATTCAGATCC
AAAAACGTCCAAACAAAATCCAAAGAGAAAAACAAGTAAGAAAATCCAAGAACCAAATGAATAATCCGCGAACTAGTTATTCTCTTTAGT
TCTCTGTTTCTTTTTTTTTTTTTTTTGAGTTGAAGAGGGAGTTTAAGTTTG
(5')AATCTTGGCGTCCAAGCTCTTGTTTGCTGCTCTCG
AAAAGACGCAGGTAACGAGGATTGGCATCCAGCgCACCGTTGATCCAGTTGATCACTTCAGAGTCAATTGGTGA(3')ACCTATTTGCAA
CCCGGAGGACTATTATTTTTTAATTGCTTTCAGTATTTTTCTTTATTAGGATGTTGAGGGGGCTTTCCCAACATCCATCTCAGTTTTAGA
GGCTTCATAGGTAGACAGTCAGATGTTAGTCCTTTAGTCTTTTCATTATCTTTCTATTGGTTAAGACTTGGGTTGCCACTTTTGGCCAAT
TGAATGTTTAATCTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan