Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U599113

Score 
128
Direction 
Reverse
Predicted Peptide Sequence 
MRGIRFNVVDVTLHADAVHRGGGQIIPTCGRAIYAAEITAAPRLMEPVYLVEIQCPERAVGGIYGVLNRRRGHVIAEEPRPGTPLYNVKA
YLPVNESFGFTADLRANTAGQAFPQXRVRPLAGPEHRSLEKGTKAYEIVMAARKRKGLKDALPDLNDYEDKLNRRAVTFVPFGTKKVLWA
HEYKALLDX
Predicted Coding Sequence 
ATGCGGGGCATCCGCTTCAACGTCGTCGACGTGACCCTGCACGCCGATGCCGTCCACCGTGGTGGCGGTCAGATCATCCCCACCTGCGGT
CGCGCCATATACGCCGCCGAGATCACCGCCGCTCCCCGCCTCATGGAGCCCGTCTACCTCGTCGAGATCCAGTGCCCCGAGCGCGCTGTC
GGTGGCATCTACGGTGTGCTCAACCGCCGCCGTGGTCACGTCATCGCTGAGGAGCCTCGCCCCGGCACTCCTCTCTACAACGTCAAGGCT
TACCTGCCTGTGAACGAGTCTTTCGGCTTCACTGCCGATCTCCGCGCCAACACCGCCGGCCAGGCCTTCCCTCAGXTGCGTGTTCGACCA
CTGGCAGGTCCTGAGCACCGATCCCTTGAGAAGGGCACCAAGGCTTACGAGATTGTCATGGCCGCTCGTAAGCGCAAGGGTCTCAAGGAT
GCCCTCCCCGACCTCAACGACTACGAGGACAAGCTGAATCGTCGCGCCGTGACCTTTGTTCCCTTTGGGACAAAAAAAGTTTTGTGGGCT
CACGAGTATAAAGCTCTATTGGATTXX
Edits in Original Sequence 
AGGAGAAC(5')ATGCGGGGCATCCGCTTCAACGTCGTCGACGTGACCCTGCACGCCGATGCCGTCCACCGTGGTGGCGGTCAGATCATC
CCCACCTGCGGTCGCGCCATATACGCCGCCGAGATCACCGCCGCTCCCCGCCTCATGGAGCCCGTCTACCTCGTCGAGATCCAGTGCCCC
GAGCGCGCTGTCGGTGGCATCTACGGTGTGCTCAACCGCCGCCGTGGTCACGTCATCGCTGAGGAGCCTCGCCCCGGCACTCCTCTCTAC
AACGTCAAGGCTTACCTGCCTGTGAACGAGTCTTTCGGCTTCACTGCCGATCTCCGCGCCAACACCGCCGGCCAGGCCTTCCCTCAGXTG
CGTGTTCGACCACTGGCAGGTCCTGAGCACCGATCCCTTcGAGAAGGGCACCAAGGCTTACGAGATTGTCATGGCCGCTCGTAAGCGCAA
GGGTCTCAAGGATGCCCTCCCCGACCTCAACGACTACGAGGACAAGCTGtAATCGTCGCGCgCGTGACCTTTGTTCCCTTTGGGACAAAA
AAAGTTTTGTGGGCTCACGAGTATAAAGCTCTATTGGATTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan