ESTScan Details for Unigene SGN-U599140

Score 
214
Direction 
Forward
Predicted Peptide Sequence 
DESLNFSAEVVNLISYSYRHCPYNQASAIEMDGAAAASSPSTIKPINKSVVHRICAGQVILDLPSAVKELVENSLDAGATSIEVSLKDYG
SESFQVIDNGCGISPQNFKVLALKHHTSKLSDFPDLQSLVTFGFRGEALSSLCALGDLTVETRTKNEQIATHLTFDHSGLLIAERNIARQ
VGTTVTVKKLFSTLPVRSKEFHRNIRKEYGKLITLLNAYALISKGVRLVCTNSAXKNAKSVVL
Predicted Coding Sequence 
GATGAATCACTGAATTTCTCAGCTGAAGTAGTAAACTTGATATCTTACAGTTACCGGCATTGCCCCTACAATCAAGCGAGCGCCATTGAA
ATGGACGGAGCAGCAGCAGCTTCTTCACCGTCGACTATTAAACCCATAAACAAGAGCGTAGTCCATAGAATTTGTGCGGGTCAAGTTATT
CTGGACCTTCCCTCTGCCGTCAAGGAATTGGTTGAAAATAGCTTGGACGCCGGAGCTACCAGCATCGAAGTCTCCCTCAAAGACTATGGT
TCTGAATCCTTCCAGGTCATTGATAACGGTTGTGGCATCTCGCCTCAAAATTTCAAGGTATTGGCGCTAAAACATCATACCTCAAAACTA
TCAGATTTTCCTGATCTTCAGTCATTAGTGACTTTTGGATTTAGAGGGGAGGCATTGAGTTCACTTTGTGCTTTAGGGGATTTGACAGTT
GAAACAAGAACAAAGAATGAGCAAATTGCGACACACTTGACTTTTGATCATTCGGGCCTTCTGATAGCTGAAAGGAACATAGCTCGCCAA
GTTGGTACCACTGTCACTGTTAAGAAGTTGTTCTCCACTTTACCAGTGAGAAGTAAAGAATTCCACCGCAATATCCGGAAGGAATATGGA
AAGCTTATCACATTGCTGAATGCCTATGCTCTTATTTCTAAGGGAGTCAGACTAGTTTGTACCAACTCAGCTXCTAAAAATGCAAAATCT
GTAGTTCTG
Edits in Original Sequence 
(5')GATGAATCACTGAATTTCTCAGCaTGAAGTAGTAAACTTGATATCTTACAGTTACCGGCATTGCCCCTACAATCAAGCGAGCGCCA
TTGAAATGGACGGAGCAGCAGCAGCTTCTTCACCGTCGACTATTAAACCCATAAACAAGAGCGTAGTCCATAGAATTTGTGCGGGTCAAG
TTATTCTGGACCTTCCCTCTGCCGTCAAGGAATTGGTTGAAAATAGCTTGGACGCCGGAGCTACCAGCATCGAAGTCTCCCTCAAAGACT
ATGGTTCTGAATCCTTCCAGGTCATTGATAACGGTTGTGGCATCTCGCCTCAAAATTTCAAGGTATTGGCGCTAAAACATCATACCTCAA
AACTATCAGATTTTCCTGATCTTCAGTCATTAGTGACTTTTGGATTTAGAGGGGAGGCATTGAGTTCACTTTGTGCTTTAGGGGATTTGA
CAGTTGAAACAAGAACAAAGAATGAGCAAATTGCGACACACTTGACTTTTGATCATTCGGGCCTTCTGATAGCTGAAAGGAACATAGCTC
GCCAAGTTGGTACCACTGTCACTGTTAAGAAGTTGTTCTCCACTTTACCAGTGAGAAGTAAAGAATTCCACCGCAATATCCGGAAGGAAT
ATGGAAAGCTTATCACATTGCTGAATGCCTATGCTCTTATTTCTAAGGGAGTCAGACTAGTTTGTACCAACTCAGCTXCTAAAAATGCAA
AATCTGTAGTTCTG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan