ESTScan Details for Unigene SGN-U599350

Score 
61
Direction 
Reverse
Predicted Peptide Sequence 
XCPTHSPFPVPDPECGGVSLEPGLDCLFHFVSLSTGMGVTDILPKLCHRLGPDPAKQEQLPTPTLS*
Predicted Coding Sequence 
XCCTGTCCTACTCATTCTCCCTTTCCCGTTCCTGACCCTGAGTGTGGAGGGGTTAGCCTTGAGCCAGGTCTTGATTGTTTATTCCATTTT
GTCAGTTTAAGTACTGGAATGGGAGTTACAGATATTCTTCCTAAACTATGTCACCGATTGGGACCTGATCCCGCTAAGCAAGAACAGCTA
CCGACACCAACTCTATCTTAA
Edits in Original Sequence 
(5')XCCTGTCCTACTCATTCTCCCTTTCCCGTTCCTGACCCTGAGTGTGGAGGGGTTAGCCTTGAGCCAGGTCTTGATTGTTTATTCCA
TTTTGTCAGTTTAAGTACTGGAATGGGAGTTACAGATATTCaTTCCTAAACTATGTCACCGATTGGtGACCTGATCCCGCTAAGCAAGAA
CAGCTACCGACACCAACTCTATCTTAA(3')CGACCGGTAAAGCCCTCTCTCTAGGATATGGCACTTCACTGCTCGGAGAGGAATGAATT
CTTCTCCAAATCATCTCTTCCTTTATTTAAGTTAAGAAAGAAGTCAATTACGTTCGAGCTTTTTGTCAACTGATTCCACTCAAGCAATAG
AAAGAAAGGCTATCTCCTCTAATCTCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan