ESTScan Details for Unigene SGN-U599404

Score 
290
Direction 
Reverse
Predicted Peptide Sequence 
XISSAAVGPRTNVTQGSMVAPFPGFKFSAPFPVTKKQNLDITSIVSKGGRVSCMQVXAPNYHEEEGPLSSLPDFFGEQLLREMESLLKKG
GVPCLEFETEPGFFFRGNNKSPGFFDGRFWPMGKFPMFGGPDATQVLAEVQEGKKASPQPGVRIIGFDKGGKGRVSVSLPPNQKGIKFHI
RNXNFF*
Predicted Coding Sequence 
XTCATTTCCTCAGCAGCGGTTGGTCCCCGCACCAATGTTACCCAAGGTAGCATGGTTGCCCCTTTCCCTGGTTTCAAATTTTCAGCCCCT
TTCCCTGTTACAAAAAAGCAAAACCTTGACATCACTTCCATTGTTAGCAAAGGGGGAAGAGTTAGCTGCATGCAGGTGGXGGCCCCCAAT
TACCATGAAGAAGAGGGGCCCCTCTCATCCCTTCCTGATTTTTTTGGGGAGCAATTGCTTAGGGAAATGGAGTCCCTTTTGAAAAAAGGA
GGGGTTCCTTGCTTGGAATTTGAGACTGAGCCCGGATTTTTTTTCCGGGGGAACAACAAGTCCCCCGGATTTTTTGATGGAAGGTTCTGG
CCCATGGGGAAGTTCCCTATGTTTGGGGGCCCTGATGCAACCCAAGTTTTGGCTGAGGTTCAAGAGGGTAAAAAGGCATCCCCCCAACCA
GGGGTCAGAATCATTGGATTTGACAAAGGGGGCAAGGGCAGGGTATCAGTTTCATTGCCTCCAAACCAGAAGGGTATTAAGTTTCATATT
AGGAACAAXAATTTTTTTTAG
Edits in Original Sequence 
(5')XTCATTTCCTCAGCAGCGGTTGGTCCCCGCACCAATGTTACCCAAGGTAGCATGGTTGCCCCTTTCCCTGGTTTCAAATTTTCAGC
CCCTTTCCCTGTTACAAAAAAGCAAAACCTTGACATCACTTCCATTGTTAGCAAAGGGGGAAGAGTTAGCTGCATGCAGGTGGXGGCCCC
CAATTACCATGAAGAAGtAGGGGCCCCTCTCATCCCTTCCTGATTTTTTTGGGGAGCAATTGCTTAGGGAAATGGAGTCCCTTTTGAAAA
AAGGAGGGGTTCCTTGCTTGGAATTTGAGACTGAGCCCGGATTTTTTTTCCGGGGGAACAACAAGTCCCCCGGATTTTTTGATGGAAGGT
TCTGGCCCATGGGGAAGTTCCCTATGTTTGGGGGCCCTGATGCAACCCAAGTTTTGGCTGAGGTTCAAGAGGGTAAAAAGGCATCCCCCC
AACCAGGGGTCAGAATCATTGGATTTGACAAAGGGGGtCAAGGGCAGGGTATCAGTTTCATTGCCTCCAAACCAGAAGGGTATTAAGTTT
CATATTAGGAACAAXAATTTTTTTTAG(3')GGCCCCCTTGTTTTTAATTGCTACTTAGGTCTTTTTTTTTTTTTTGTTTTAATTCCAAC
AAACTATTTTATGTTTTTTACTATTCCGGTTTATGTTTTGGAGGTAGAGGGTCCCTAAATGATATGATAAAGATNTTGGGGGCTTTGTTT
GTAAAAACAAAAAAAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan