ESTScan Details for Unigene SGN-U599652

Score 
557
Direction 
Forward
Predicted Peptide Sequence 
XLTSCCLYGNSPMGQQQVQLKRGVDIVVGTPGRIKDHIERGNIDFRSLKFRVLDEVDEMLKIGFVDDVEFILGKVEDASQVQTLLFSATL
PSWVKHISSKFLKPDKKTADLVGDEKMKASKNVRHIIIPCSSSARSQLIPDIIRCYSSGGRTIIFTETRGYASELAGILPGARALHGDIQ
QSQREITLSGFRSGKFLTLVATNV
Predicted Coding Sequence 
XGGCTAACTTCATGTTGTTTATATGGAAATTCACCCATGGGACAACAACAAGTTCAACTAAAAAGAGGAGTTGATATCGTCGTAGGTACT
CCTGGAAGAATTAAGGACCACATCGAAAGAGGAAATATTGATTTCAGGTCCCTAAAGTTCCGTGTTCTTGATGAAGTTGATGAAATGTTG
AAAATTGGTTTTGTTGATGATGTTGAATTTATATTAGGCAAGGTAGAAGATGCAAGCCAAGTTCAAACACTTCTTTTCAGTGCAACTTTG
CCGAGCTGGGTGAAGCATATATCTTCGAAGTTTCTCAAACCTGATAAGAAAACAGCTGATCTTGTTGGTGATGAGAAAATGAAGGCCAGC
AAGAATGTGAGGCATATTATTATACCATGCTCTAGTTCAGCCAGATCTCAGCTGATTCCTGATATAATTCGCTGCTACAGCAGTGGTGGA
CGCACAATTATTTTCACTGAGACAAGGGGTTATGCTTCGGAGCTAGCTGGCATATTGCCTGGGGCACGTGCTTTGCATGGAGACATACAA
CAATCCCAGCGTGAGATTACACTTTCTGGATTCAGATCAGGAAAGTTCCTTACATTAGTGGCCACAAATGTX
Edits in Original Sequence 
(5')XGGCTAACTTCATGTTGTTTATATGGAAATTCACCCATGGGACAACAACAAGTTCAACTAAAAAGAGGAGTTGATATCGTCGTAGG
TACTCCTGGAAGAATTAAGGACCACATCGAAAGAGGAAATATTGATTTCAGGTCCCTAAAGTTCCGTGTTCTTGATGAAGTTGATGAAAT
GTTGAAAATTGGTTTTGTTGATGATGTTGAATTTATATTAGGCAAGGTAGAAGATGCAAGCCAAGTTCAAACACTTCTTTTCAGTGCAAC
TTTGCCGAGCTGGGTGAAGCATATATCTTCGAAGTTTCTCAAACCTGATAAGAAAACAGCTGATCTTGTTGGTGATGAGAAAATGAAGGC
CAGCAAGAATGTGAGGCATATTATTATACCATGCTCTAGTTCAGCCAGATCTCAGCTGATTCCTGATATAATTCGCTGCTACAGCAGTGG
TGGACGCACAATTATTTTCACTGAGACAAGGGGTTATGCTTCGGAGCTAGCTGGCATATTGCCTGGGGCACGTGCTTTGCATGGAGACAT
ACAACAATCCCAGCGTGAGATTACACTTTCTGGATTCAGATCAGGAAAGTTCCTTACATTAGTGGCCACAAATGTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan