ESTScan Details for Unigene SGN-U599887

Score 
329
Direction 
Forward
Predicted Peptide Sequence 
GDHEHPWPXVGDHHCTIPKTVGQLKSLNILDLSENLLYGIVPVEIGGATSLMELSLDKNSLTGEIPSSVGYCSSLVSLSLSHNSLTGPVP
EALAKLTYLQSVDLSFNKLTGVLPKQLGDLGHLSFFNISHNQLQGELPSSGFFNTISPYSVSANPSLCGAAVNRSCSTVMPKPIVLNPNS
TDS
Predicted Coding Sequence 
GGCGATCATGAACACCCATGGCCTAXGGTTGGTGACCATCATTGCACCATTCCTAAGACAGTCGGTCAATTGAAATCCTTGAATATTCTT
GATTTGAGTGAAAATCTCTTATATGGTATTGTCCCTGTGGAAATTGGAGGAGCAACATCTCTCATGGAACTTAGTCTGGATAAAAATTCC
TTGACTGGAGAAATTCCTAGTTCAGTTGGCTATTGTTCTTCATTGGTATCGTTGTCTTTATCACATAACAGTCTAACTGGTCCTGTACCT
GAAGCCCTAGCAAAACTGACTTACCTTCAAAGTGTTGACTTATCCTTTAACAAATTAACTGGAGTCTTGCCAAAGCAGCTTGGAGATCTT
GGCCATCTCTCTTTCTTCAACATTTCACACAACCAGCTACAAGGCGAACTACCTTCTAGTGGTTTTTTTAATACCATTTCTCCTTATTCT
GTGTCAGCAAACCCATCTCTATGTGGGGCTGCTGTCAACAGGTCATGTTCTACAGTCATGCCCAAGCCAATTGTTCTGAATCCCAACTCC
ACTGATTCX
Edits in Original Sequence 
(5')GGCGATCATGAACACCCATGGCCTAXGGTTGGTGACCATCATTGCACCATTCCTAAGACAGTCGGTCAATTGAAATCCTTGAATAT
TCTTGATTTGAGTGAAAATCTCTTATATGGTATTGTCCCTGTGGAAATTGGAGGAGCAACATCTCTCATGGAACTTAGTCTGGATAAAAA
TTCCTTGACTGGAGAAATTCCTAGTTCAGTTGGCTATTGTTCTTCATTGGTATCGTTGTCTTTATCACATAACAGTCTAACTGGTCCTGT
ACCTGAAGCCCTAGCAAAACTGACTTACCTTCAAAGTGTTGACTTATCCTTTAACAAATTAACTGGAGTCTTGCCAAAGCAGCTTGGAGA
TCTTGGCCATCTCTCTTTCTTCAACATTTCACACAACCAGCTACAAGGCGAACTACCTTCTAGTGGTTTTTTTAATACCATTTCTCCTTA
TTCTGTGTCAGCAAACCCATCTCTATGTGGGGCTGCTGTCAACAGGTCATGTTCTACAGTCATGCCCAAGCCAATTGTTCTGAATCCCAA
CTCCACTGATTCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan