ESTScan Details for Unigene SGN-U600243

Score 
90
Direction 
Forward
Predicted Peptide Sequence 
DSDLVTLKISIFGDCQIGKTSFVIKYVGDEQEKRCLQTKGLNLMDKTLVVRGARIAFRIWDVGGDHSSFDQIPIACKDSVAILFMFDLTS
RSTLNNVISWYTEARKWNQTAIPILIGTKFDD
Predicted Coding Sequence 
GATTCAGATTTAGTTACTTTAAAGATCAGTATTTTTGGTGATTGTCAGATTGGTAAAACAAGTTTTGTGATTAAGTATGTAGGTGATGAA
CAAGAAAAGAGGTGCTTGCAGACGAAGGGATTGAACTTAATGGATAAAACATTAGTTGTACGAGGTGCACGAATTGCATTTAGAATATGG
GATGTAGGAGGTGATCATAGCTCATTTGATCAGATTCCAATAGCTTGTAAAGATTCTGTTGCCATTCTCTTTATGTTCGATCTCACTAGC
CGGAGTACATTGAACAATGTGATAAGTTGGTATACTGAAGCAAGAAAATGGAATCAGACTGCTATTCCAATACTAATTGGGACCAAATTT
GATGAT
Edits in Original Sequence 
(5')GATTCAGATTTAGTTACTTTAAAGATCAGTATTTTTGGTGATTGTCAGATTGGTAAAACAAGTTTTGTGATTAAGTATGTAGGTGA
TGAACAAGAAAAGAGGTGCTTGCAGACGAAGGGATTGAACTTAATGGATAAAACATTAGTTGTACGAGGTGCACGAATTGCATTTAGAAT
ATGGGATGTAGGAGGTGATCATAGCTCATTTGATCAGATTCCAATAGCTTGTAAAGATTCTGTTGCCATTCTCTTTATGTTCGATCTCAC
TAGCCGGAGTACATTGAACAATGTGATAAGTTGGTATACTGAAGCAAGAAAATGGAATCAGACTGCTATTCCAATACTAATTGGGACCAA
ATTTGATGAT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan