ESTScan Details for Unigene SGN-U600411

Score 
407
Direction 
Forward
Predicted Peptide Sequence 
GLIALCXIRVVVXAISSFGSLDSLRDLDSVFIVGCFNSVKLHTVRLVDXMGSEGPPAVTIHVTGFKKFHGVAENPTETIVSNLKEYVKKR
GLPKGVILGSCSILETAGQGAVVPLYQTLQSAISTAKNESSTPGRVIWVHFGVNSGATKFAIENQAVNEATFRCPDEMGWKPQKVPIIPA
DGGISRARETSLPVEEITKALAKMGYEVMTSDDAGRFVCNYVYYHSLRFAEQNGIKSLFVHVPLFFTIDEETQMQFAASLLEVLASLS*
Predicted Coding Sequence 
GGCTTAATAGCTTTGTGTAXGATAAGAGTGGTGGTTGXAGCCATTTCTTCTTTTGGCTCCCTTGATTCCCTCAGGGATCTAGATTCTGTT
TTTATCGTTGGATGCTTTAACAGTGTAAAGCTTCATACCGTAAGGCTTGTTGATXTGATGGGGTCTGAAGGGCCTCCTGCTGTAACCATC
CATGTGACTGGTTTTAAAAAATTTCATGGAGTTGCGGAGAATCCTACTGAGACAATTGTCAGTAATCTAAAAGAGTATGTGAAAAAAAGG
GGTTTGCCCAAAGGGGTAATCCTTGGCAGTTGCAGTATTCTTGAGACTGCAGGACAGGGAGCAGTTGTTCCTTTATATCAGACACTGCAA
TCTGCTATCAGCACAGCTAAGAACGAGTCATCCACTCCTGGTAGAGTTATTTGGGTCCATTTCGGAGTTAATAGTGGTGCAACAAAGTTT
GCAATAGAGAATCAAGCAGTCAATGAAGCTACATTTCGCTGCCCTGATGAGATGGGGTGGAAGCCTCAGAAAGTCCCTATTATCCCAGCA
GATGGTGGAATTTCAAGAGCACGAGAGACTTCTCTTCCTGTTGAAGAGATCACAAAGGCATTGGCAAAGATGGGCTATGAAGTGATGACC
TCTGATGATGCTGGCCGATTTGTGTGCAACTATGTATACTATCATTCCTTGCGTTTCGCAGAGCAGAATGGAATCAAATCTCTATTTGTA
CATGTGCCTCTCTTCTTTACTATAGATGAGGAGACACAAATGCAATTTGCTGCTTCCTTATTGGAGGTACTTGCCTCTTTATCTTAG
Edits in Original Sequence 
(5')GGCTTAATAGCTTTGTGTAXGATAAGAGTGGTGGTTGXAGCCATTTCTTCTTTTGGCTCCCTTGATTCCCTCAGGGATCTAGATaT
CTGTTTTTATCGTTGGATGCTTTAACAGTGTAAAGCTTCATACCGTAAGGCTTGTTGATXTGATGGGGTCTGAAGGGCCTCCTGCTGTAA
CCATCCATGTGACTGGTTTTAAAAAATTTCATGGAGTTGCGGAGAATCCTACTGAGACAATTGTCAGTAATCTAAAAGAGTATGTGAAAA
AAAGGGGTTTGCCCAAAGGGGTAATCCTTGGCAGTTGCAGTATTCTTGAGACTGCAGGACAGGGAGCAGTTGTTCCTTTATATCAGACAC
TGCAATCTGCTATCAGCACAGCTAAGAACGAGTCATCCACTCCTGGTAGAGTTATTTGGGTCCATTTCGGAGTTAATAGTGGTGCAACAA
AGTTTGCAATAGAGAATCAAGCAGTCAATGAAGCTACATTTCGCTGCCCTGATGAGATGGGGTGGAAGCCTCAGAAAGTCCCTATTATCC
CAGCAGATGGTGGAATTTCAAGAGCACGAGAGACTTCTCTTCCTGTTGAAGAGATCACAAAGGCATTGGCAAAGATGGGCTATGAAGTGA
TGACCTCTGATGATGCTGGCCGATTTGTGTGCAACTATGTATACTATCATTCCTTGCGTTTCGCAGAGCAGAATGGAATCAAATCTCTAT
TTGTACATGTGCCTCTCTTCTTTACTATAGATGAGGAGACACAAATGCAATTTGCTGCTTCCTTATTGGAGGTACTTGCCTCTTTATCTT
AG(3')ACTCTCACATTCTTGTCTCTCTTTTCATCTCGATCTGGTGGCATATTTGCCTCGTCGTGGTCGTCGTGCATGTGACGATGGATG
CAGATATCTCTGTGTCATGCTTCAATAAACTTTTAATTGTGTGTGGAATGGAAATGCGATTTTTGCTGATGAATTAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan