Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U600537

Score 
413
Direction 
Forward
Predicted Peptide Sequence 
XKASNFLADMVHEGFLPDVVGYSAVIDGLVKIKQLDDALNLFRGICARGYCPDVVAYNIMINGLCKAKRVLDAQNLLDEMMAKGLIPSVV
TYNSLIDGWCKNGDVDRAIAYLTRMNVKEREPNVITYTTLIDGLCNAGKPSDAISLLVNMEANGCSPNRITFMALISGLCKCRKPDDALI
YLQEMERKDMKPDPSIYIVLIDAFIKNMNPNEACELLQKVVHDESLLDLNIKSRPIX
Predicted Coding Sequence 
XGCAAAGCTTCTAACTTTCTTGCTGACATGGTTCATGAAGGATTTCTCCCTGATGTAGTTGGTTATTCGGCAGTCATAGACGGCCTTGTT
AAGATTAAACAGTTGGATGATGCACTGAATCTTTTCAGAGGGATCTGTGCTCGGGGTTATTGCCCTGATGTGGTTGCTTATAACATTATG
ATAAATGGGCTTTGTAAGGCCAAAAGGGTACTTGACGCCCAGAATCTTCTTGATGAAATGATGGCTAAGGGACTTATTCCATCAGTTGTT
ACCTACAACTCACTGATTGATGGGTGGTGCAAAAATGGTGATGTAGATCGAGCAATTGCATATCTCACTAGGATGAATGTAAAAGAACGG
GAGCCCAATGTTATCACTTACACCACTTTAATAGATGGGTTATGCAATGCCGGCAAACCAAGTGATGCTATTAGTCTTTTGGTCAATATG
GAGGCAAATGGGTGCTCTCCAAATAGAATAACTTTTATGGCTCTCATTAGTGGTCTGTGCAAGTGTCGGAAGCCAGATGATGCTCTGATT
TATCTGCAGGAAATGGAGAGGAAGGATATGAAACCCGATCCATCGATCTACATAGTGCTAATAGATGCCTTTATAAAAAATATGAATCCT
AATGAAGCTTGTGAGCTACTACAAAAGGTGGTCCATGACGAGTCTCTTCTAGATTTAAATATTAAGAGTCGACCTATTCXX
Edits in Original Sequence 
(5')XGCAAAGCTTCTAACTTTCTTGCTGACATGGTTCATGAAGGATTTCTCCCTGATGTAGTTGGTTATTCGGCAGTCATAGACGGCCT
TGTTAAGATTAAACAGTTGGATGATGCACTGAATCTTTTCAGAGGGATCTGTGCTCGGGGTTATTGCCCTGATGTGGTTGCTTATAACAT
TATGATAAATGGGCTTTGTAAGGCCAAAAGGGTACTTGACGCCCAGAATCTTCTTGATGAAATGATGGCTAAGGGACTTATTCCATCAGT
TGTTACCTACAACTCACTGATTGATGGGTGGTGCAAAAATGGTGATGTAGATCGAGCAATTGCATATCTCACTAGGATGAATGTAAAAGA
ACGGGAGCCCAATGTTATCACTTACACCACTTTAATAGATGGGTTATGCAATGCCGGCAAACCAAGTGATGCTATTAGTCTTTTGGTCAA
TATGGAGGCAAATGGGTGCTCTCCAAATAGAATAACTTTTATGGCTCTCATTAGTGGTCTGTGCAAGTGTCGGAAGCCAGATGATGCTCT
GATTTATCTGCAGGAAATGGAGAGGAAGGATATGAAACCCGATCCATCGATCTACATAGTGCTAATAGATGCCTTTATAAAAAATATGAA
TCCTAATGAAGCTTGTGAGCTACTACAAAAGGTGGTCCATGACGAGTCTCTTCTAGATTTAAATATTAAGAGTCGACCTATTCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan