ESTScan Details for Unigene SGN-U601090

Score 
140
Direction 
Forward
Predicted Peptide Sequence 
XREDPSMQGPSGSRSVVASGHSSIGTIMAGNQIAKVKPPPTQAEVQNIIPKHKAVGIQLFKPXIWAAFEVGVNLVVLCPDSGVKGCWFKF
KAIHVSQKYQKFNIMSSRIVMVLKSSRSHNNRDYNLNLYTITYDILAYINLLLYLYHIFSSPLFDLWNGLLPTELEDMKNWASDTHGTSQ
FRPNRWGIISEYSLEXESCRCMLDGLRGDGKDVVVFX
Predicted Coding Sequence 
XGCAGAGAAGATCCTTCAATGCAAGGACCTAGTGGGAGTAGAAGTGTCGTTGCGAGTGGCCATTCTAGTATCGGAACTATAATGGCTGGC
AATCAAATTGCAAAAGTCAAACCACCACCAACTCAGGCXGAAGTCCAAAATATAATTCCCAAGCACAAGGCAGTTGGAATTCAGCTTTTT
AAGCCTXTAATTTGGGCTGCTTTTGAAGTTGGTGTCAACTTAGTGGTTCTTTGCCCTGATAGTGGCGTGAAAGGTTGTTGGTTCAAGTTT
AAGGCTATACATGTATCACAAAAATATCAAAAGTTCAATATAATGTCATCTAGGATTGTGATGGTCCTTAAAAGCTCGAGGTCCCATAAC
AACCGTGACTATAACTTAAATCTGTATACTATAACATATGATATACTTGCATATATTAACTTGTTGCTCTACCTTTACCATATTTTTTCA
TCACCTTTGTTTGATTTATGGAATGGATTACTTCCTACTGAGTTGGAGGATATGAAAAATTGGGCTTCAGATACACATGGCACATCACAG
TTCAGACCCAACCGCTGGGGGATTATTTCTGAGTATTCTTTAGAAXTAGAAAGTTGTAGATGTATGCTTGATGGGCTGAGGGGTGATGGA
AAAGATGTTGTTGTATTTGXX
Edits in Original Sequence 
(5')XGCAGAGAAGATCCTTCAATGCAAGGACCTAGTGGGAGTAGAAGTGTCGTTGCGAGTGGCCATTCTAGTATCGGAACTATAATGGC
TGGCAATCAAATTGCAAAAGTCAAACCACCACCAACTCAGGCXGAAGTCCAAAATATAATTCCCAAGCACAAGGCAGTTGGAATTCAGCT
TTTTAAGCCTXTAATTTGGGCTGtCTTTTGAAGTTGGTGTCAACTTAGTGGTTCTTTGCCCTGATAGTGGCGTGAAAGGTTGTTGGTTCA
AGTTTAAGGCTATACATGTATCACAAAAATATCtAAAAGTTCAATATAATGTCATCTAGGATTGTGATGGTCCTTAAAAGCTCGAGGTCC
CATAACAACCGTGACTATAACTTAAATCTGTATACTATAACATATGATATACTTGCATATATTAACTTGTTcGCTCTACCTTTACCATAT
TTTTTCATCACCTTTGTTTGATTTATaGGAATGGATTACTTCCTACTGAGTTGGAGGATATGAAAAATTGGGCTTCAGATACACATGGCA
CATCACAGTTCAGACCCAACCGCTGGGGGATTATTTCTGAGTATTCTTTAGAAXTAGAAAGTTGTAGATGTATGCTTGATGGGCTGAGGG
GTGATGGAAAAGATGTTGTTGTATTTGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan