ESTScan Details for Unigene SGN-U601108

Score 
271
Direction 
Forward
Predicted Peptide Sequence 
GFELDASRSIQELGGISTSMERQKAILQELMIVVKDMLRNTEVAVRSFMMLRPKFLHQSAPATASATAPSQASGATVAPTASGSAQSTPN
AVIFDFYSGIPKKPSPFLQQTVARFEKYLVECRQWVEELEQLMALDSDRNSMNSNSSMVQSX
Predicted Coding Sequence 
GGTTTTGAGTTGGATGCAAGCCGCAGCATTCAGGAACTTGGTGGAATTAGTACATCAATGGAAAGACAAAAGGCTATCTTGCAAGAGCTA
ATGATTGTTGTTAAAGATATGCTGCGCAATACAGAGGTTGCAGTGCGCTCTTTTATGATGTTACGCCCAAAATTTCTTCATCAAAGTGCA
CCTGCTACTGCAAGCGCTACTGCTCCATCACAGGCATCAGGTGCAACTGTAGCTCCAACAGCATCTGGTTCAGCTCAGTCTACCCCCAAT
GCGGTAATTTTTGATTTTTACAGTGGGATACCAAAAAAGCCCTCTCCCTTTTTGCAGCAAACCGTAGCAAGATTTGAGAAATATCTTGTC
GAATGCCGACAATGGGTTGAAGAATTGGAGCAGTTGATGGCCTTAGATTCTGACAGGAATTCTATGAACTCCAATTCATCTATGGTGCAG
TCTCXX
Edits in Original Sequence 
(5')GGTTTTGAGTTGGATGCAAGCCGCAGCATTCAGGAACTTGGTGGAATTAGTACATCAATGGAAAGACAAAAGGCTATCTTGCAAGA
GCTAATGATTGTTGTTAAAGATATGCTGCGCAATACAGAGGTTGCAGTGCGCTCTTTTATGATGTTACGCCCAAAATTTCTTCATCAAAG
TGCACCTGCTACTGCAAGCGCTACTGCTCCATCACAGGCATCAGGTGCAACTGTAGCTCCAACAGCATCTGGTTCAGCTCAGTCTACCCC
CAATGCGGTAATTTTTGATTTTTACAGTGGGATACCAAAAAAGCCCTCTCCCTTTTTGCAGCAAACCGTAGCAAGATTTGAGAAATATCT
TGTCGAATGCCGACAATGGGTTGAAGAATTGGAGCAGTTGATGGCCTTAGATTCTGACAGGAATTCTATGAACTCCAATTCATCTATGGT
GCAGTCTCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan