ESTScan Details for Unigene SGN-U601131

Score 
-40
Direction 
Reverse
Predicted Peptide Sequence 
RALDSSDVELVKLMVMGEGLNLDESIALHYAVENCSREVVKALLELGAANVNHPAGPAGKTPLHIASEMVSPDMVAVLLDHHADPNVRTM
DGITPLDILQTLTSDFLFKGAIPGLTHIEPNKLRLCLXVSSSREITIA
Predicted Coding Sequence 
CGAGCCCTAGACTCATCCGACGTGGAATTGGTCAAACTTATGGTCATGGGAGAAGGACTAAATCTCGATGAATCGATCGCGTTACACTAC
GCGGTCGAGAATTGTAGCCGGGAGGTTGTGAAAGCGTTACTCGAGCTCGGTGCAGCCAACGTGAACCACCCGGCCGGTCCAGCTGGCAAA
ACCCCCCTCCACATTGCATCGGAAATGGTGTCACCCGACATGGTGGCAGTCCTACTAGACCACCACGCAGATCCAAATGTCAGAACGATG
GATGGGATCACTCCACTCGACATTCTACAAACCCTAACTTCCGATTTCTTATTCAAAGGTGCGATCCCTGGTCTAACTCATATCGAACCA
AACAAACTACGTCTATGTCTTGXAGTTTCTTCCTCTCGTGAAATTACCATAGCC
Edits in Original Sequence 
(5')CGAGCCCTAGACTCATCCGACGTGGAATTGGTCAAACTTATGGTCATGGGAGAAGGACTAAATCTCGATGAATCGATCGCGTTACA
CTACGCGGTCGAGAATTGTAGCCGGGAGGTTGTGAAAGCGTTACTCGAGCTCGGTGCAGCCAACGTGAACCACCCGGCCGGTCCAGCTGG
CAAAACCCCCCTCCACATTGCATCGGAAATGGTGTCACCCGACATGGTGGCAGTCCTACTAGACCACCACGCAGATCCAAATGTCAGAAC
GATGGATGGGATCACTCCACTCGACATTCTACAAACCCTAACTTCCGATTTCTTATTCAAAGGTGCGATCCCTGGTCTAACTCATATCGA
ACCAAACAAACTACGTCTATGTCTTGXAGTTTCTTCCTCTCGTGAAATTACCATAGCC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan