ESTScan Details for Unigene SGN-U601197

Score 
681
Direction 
Forward
Predicted Peptide Sequence 
XKRIIPESVGFPIPLENTSGIAQSPVVEFPNMTVEQRKDDNGMVLSGASVRDGFARKTVSVSADQRERSGVTARATISDSLIIEKVPPSA
CKDGSVGIEQMGIVKDPPHSGTGGTLLIRVFDNKEGVDIGPICLEAQSREQAANDVLGTGNSFVIKETEILCSRGAQTLWSDRISGKVTV
LAGNANFWAVGCEDGCXSDLYKMWPTCHADHDEWDXAAVFVDCDESWDFLLVTGKVHYX
Predicted Coding Sequence 
XXGAAGAGGATAATCCCAGAATCAGTTGGTTTTCCTATCCCACTGGAGAACACCTCTGGAATTGCTCAATCTCCTGTTGTTGAATTTCCT
AATATGACAGTGGAGCAAAGGAAAGATGATAATGGTATGGTACTGTCTGGTGCTAGTGTTAGAGATGGATTTGCAAGGAAAACAGTTAGT
GTCAGTGCTGATCAAAGGGAGCGCTCAGGTGTAACTGCTAGAGCTACCATCAGTGATAGCCTCATCATTGAGAAGGTTCCACCTTCTGCA
TGCAAGGATGGAAGTGTCGGCATTGAACAGATGGGAATTGTCAAGGATCCTCCTCATTCGGGTACTGGTGGTACACTTTTAATCAGGGTT
TTTGATAATAAAGAAGGGGTGGACATTGGTCCAATTTGCTTAGAGGCTCAATCCAGAGAACAAGCTGCCAATGATGTTTTGGGGACAGGA
AATTCATTTGTAATAAAAGAAACTGAGATACTTTGTTCCAGAGGCGCTCAAACTCTCTGGTCTGACCGGATTTCTGGAAAAGTTACTGTT
TTGGCTGGAAATGCCAACTTTTGGGCTGTGGGATGTGAAGACGGCTGCATXTCAGATTTATACAAAATGTGGCCGACGTGCCATGCCGAC
CATGATGAATGGGATXCTGCTGCAGTATTTGTTGATTGTGATGAATCTTGGGACTTTTTGCTCGTCACAGGAAAGGTTCATTACAXX
Edits in Original Sequence 
(5')XXGAAGAGGATAATCCCAGAATCAGTTGGTTTTCCTATCCCACTGGAGAACACCTCTGGAATTGCTCAATCTCCTGTTGTTGAATT
TCCTAATATGACAGTGGAGCAAAGGAAAGATGATAATGGTATGGTACTGTCTGGTGCTAGTGTTAGAGATGGATTTGCAAGGAAAACAGT
TAGTGTCAGTGCTGATCAAAGGGAGCGCTCAGGTGTAACTGCTAGAGCTACCATCAGTGATAGCCTCATCATTGAGAAGGTTCCACCTTC
TGCATGCAAGGATGGAAGTGTCGGCATTGAACAGATGGGAATTGTCAAGGATCCTCCTCATTCGGGTACTGGTGGTACACTTTTAATCAG
GGTTTTTGATAATAAAGAAGGGGTGGACATTGGTCCAATTTGCTTAGAGGCTCAATCCAGAGAACAAGCTGCCAATGATGTTTTGGGGAC
AGGAAATTCATTTGTAATAAAAGAAACTGAGATACTTTGTTCCAGAGGCGCTCAAACTCTCTGGTCTGACCGGATTTCTGGAAAAGTTAC
TGTTTTGGCTGGAAATGCCAACTTTTGGGCTGTGGGATGTGAAGACGGCTGCATXTCAGATTTATACAAAATGTGGCCGACGTGCCATGC
CGACCATGATGAATGGGATXCTGCTGCAGTATTTGTTGATTGTGATGAATCTTGGGACTTTTTGCTCGTCACAGGAAAGGTTCATTACAX
X(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan