ESTScan Details for Unigene SGN-U601417

Score 
428
Direction 
Forward
Predicted Peptide Sequence 
GRLLAIMGPSGSGKTTLLNVLAGQTKASPKLNLSGLLDINGVPFSNKIYKFAYVRQEDLFFSQLTVRETLSLAAELQLQDVSSIEERDEY
VNNLLFKTGLLADSQIGDAKVRGISGGEKKRLSLACELIASPSVVFADEPTTGSDATVFASPVFAGVMLWS*
Predicted Coding Sequence 
GGTCGATTGCTAGCAATAATGGGTCCATCAGGATCAGGAAAGACTACTCTTCTCAATGTTCTGGCGGGTCAAACAAAAGCATCACCTAAG
TTGAATTTGTCTGGTCTTTTGGACATCAACGGGGTGCCATTTTCAAACAAAATATACAAGTTTGCCTATGTTAGACAAGAAGATCTTTTC
TTTTCCCAGTTGACTGTTCGAGAAACTCTCTCTCTTGCAGCTGAACTGCAGCTACAGGACGTATCTTCAATAGAAGAGAGAGATGAATAT
GTGAACAATCTATTGTTTAAAACAGGTTTGTTGGCTGATTCACAAATTGGTGATGCAAAAGTTCGTGGAATTAGTGGAGGTGAAAAGAAG
CGCCTGTCGCTTGCATGTGAGCTTATTGCCAGTCCATCTGTAGTTTTTGCTGATGAACCTACCACTGGAAGTGATGCTACTGTTTTTGCT
AGTCCXGTGTTTGCTGGCGTTATGCTTTGGTCATAA
Edits in Original Sequence 
(5')GGTCGATTGCTAGCAATAATGGGTCCATCAGGATCAGGAAAGACTACTCTTCTCAATGTTCTGGCGGGTCAAACAAAAGCATCACC
TAAGTTGAATTTGTCTGGTCTTTTGGACATCAACGGGGTGCCATTTTCAAACAAAATATACAAGTTTGCCTATGTTAGACAAGAAGATCT
TTTCTTTTCCCAGTTGACTGTTCGAGAAACTCTCTCTCTTGCAGCTGAACTGCAGCTACAGGACGTATCTTCAATAGAAGAGAGAGATGA
ATATGTGAACAATCTATTGTTTAAAACAGGTTTGTTGtGCTGATTCACAAATTGGTGATGCAAAAGTTCGTGGAATTAGTGGAGGTGAAA
AGAAGCGCCTGTCGCTTGCATGTGAGCTTATTGCCAGTCCATCTGTAGTTTTTGCTGATGAACCTACCACTGGtAAGTGATGCTACTGTT
TTTGCTAGTCCXGTGTTTGCTGGCGTTATGCTTTGGTCATAA(3')TGGTATCATCCAATTTTTCTGCATTTATTCAACTTATATGCTTT
CATTTTTTATTAATAAACTAGTCATTACAACGTTTTTAGAAGCACGTATAGACCAAGGAGTGTCTTTATAAAATCAGAGGTTTTGAAGTA
GGATAACTATATATTTATGGCCACTATGCTTCCCTGTAGAGTGTAGTCTTCTCTAGAAGGGACTCCCAATTTTCACTTTTATCTCATCTA
TCTTTCACTTGTAATGGTGCTGACGTCCTGGCCACAACCATTATCCAGTTGTGCTGACTCCTTATTTACATGCTGTGTCAAACTTTCAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan