ESTScan Details for Unigene SGN-U601546

Score 
26
Direction 
Forward
Predicted Peptide Sequence 
XAYGTLLLKFLTNGFSDGDFAGNKNDXKKHKQNMSTFXDILSSLGIVKGRNXIVLSTTKSDNLAVGSCGTQLLWMMHQIMDYSLTFEGAP
IFCDNTSAISLSKYTVHHSRANHIDIGHHFICDHVENGDFVLKFFDYENQLADIFTDPLLEELSVSFDKALALLDLIINFYTIPITFPFA
DSYRLFIKRQELLCSQSVGCHHEXPRTAPS
Predicted Coding Sequence 
XXGGCTTATGGCACCCTTCTTCTGAAATTTTTGACTAATGGTTTTTCAGATGGAGACTTTGCAGGTAACAAAAACGATAAXAAGAAACAC
AAGCAGAACATGTCAACTTTTAGXGACATTCTCTCATCTCTTGGCATAGTAAAAGGTAGAAATXCTATTGTTCTCTCAACTACTAAGTCT
GACAATTTAGCAGTCGGAAGTTGTGGCACTCAATTACTTTGGATGATGCATCAAATTATGGATTACAGTCTAACATTTGAGGGAGCACCT
ATTTTTTGTGATAACACAAGTGCTATCAGTTTATCTAAATATACTGTTCATCATTCAAGGGCAAATCATATTGATATTGGACATCATTTT
ATTTGTGATCATGTTGAAAATGGTGATTTTGTTCTTAAATTTTTTGATTATGAGAATCAATTGGCAGATATATTTACCGATCCTTTACTT
GAGGAACTTTCTGTTTCCTTCGATAAAGCCTTGGCATTATTAGACTTAATCATTAATTTTTATACTATTCCTATTACTTTTCCTTTTGCA
GATTCATACCGCCTTTTCATTAAAAGACAGGAGCTGCTCTGCTCACAATCAGTTGGTTGTCACCATGAAXCACCTCGTACTGCTCCTTCX
Edits in Original Sequence 
(5')XXGGCTTATGGCACCCTTCTTCTGAAATTTTTGACTAATcGGTTTTTCAGATGGAGACTTTGCAGGTAACAAAAACGATAAXAAGA
AACACAAGCAGAACATGTCAACTTTTAGXGACATTCTCTCATCTCTTGGCATAGTAAAAGGTAGAAATXCTATTGTTCTCTCAACTACTA
AGTCTGACAATTTAGCAGTCGGAAGTTGTGGCACTCAATTACTTTGGATGATGCATCAAATTATGGATTACAGTCTAACATTTGAGGGAG
CACCTATTTTTTGTGATAACACAAGTGCTATCAGTTTATCTAAATATACTGTTCATCATTCAAGGGCAAATCATATTGATATTGGACATC
ATTTTATTTGTGATCATGTTGAAAATGGTGATTTTGTTCTTAAATTTTTTGATTATGAGAATCAATTGGCAGATATATTTACCGATCCTT
TACTTGAGGAACTaTTCTGTTTCCTTCGATAAAGCCTTGGCATTATTAGACTTAATCATTAATTTTTATACTATTCCTaATTACTTTTCC
TTTTGCAGATTCATACCGCCTTTTCATTAAAAGACAGGAGCTGaCTCTGCTCACAATCAGTTGGTTGTCACCATGAAXCACCTCGTACTG
CTCCTTCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan