ESTScan Details for Unigene SGN-U601602

Score 
231
Direction 
Forward
Predicted Peptide Sequence 
IYIRISAIIPLKFDYFSYNILGIFFYGDVDEESNEGVFLTWNDLCVSVSTGSKNIIEGVTGYARPTQLLAVMGPSGSGKSTLLDAVAGXT
GFQHVTDGDILINGYKPKLSYGTCAY
Predicted Coding Sequence 
ATTTATATACGCATTTCCGCAATTATTCCTCTAAAATTTGATTATTTTAGCTACAATATACTTGGTATATTTTTCTATGGAGATGTGGAT
GAAGAATCGAATGAAGGTGTTTTCTTGACATGGAATGATTTGTGTGTCTCTGTTTCTACTGGAAGCAAAAACATAATTGAAGGTGTCACT
GGCTATGCTCGCCCAACTCAACTATTGGCTGTAATGGGTCCTTCTGGCTCTGGAAAATCTACACTTCTCGACGCGGTAGCTGGGCXGACT
GGATTTCAACACGTGACAGATGGGGATATTCTAATCAATGGTTACAAGCCAAAACTTTCTTATGGAACTTGTGCATAT
Edits in Original Sequence 
(5')ATTTATATACGCATTTCCGCAATTATTCCTCTAAAATTTGATTATTTTAGCTACAATATACTTGGTATATTTTTCTATGGAGATGT
gGGATGAAGAATCGAATGAAGGTGTTTTCTTGACATGGAATGATTTGTGTGTCTCTGTTTCTACTGGAAGCAAAAACATAATTGAAGGTG
TCACTGGCTATGCTCGCCCAACTCAACTATTGGCTGTAATGGGTCCTTCTGGCTCTGGAAAATCTACACTTCTCGACGCGGTAGCTGGGC
XGACTGGATTTCAACACGTGACAGAgTGGGGATATTCTAATCAATGGTTACAAGCCAAAACTTTCTTATGGAACTTGTGCATAT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan