ESTScan Details for Unigene SGN-U601801

Score 
112
Direction 
Forward
Predicted Peptide Sequence 
XAGDTLIQHVNILVTSGSLIPSLVKCLLFRLGDLFPSENVYSSWEVGKLQCFSWIKERFNGPNVQFCVIGDGWEECEAAESMRWPFVKID
PLPSSFHRFPGLTPKDLGHYFSVVYGNADEKDN*
Predicted Coding Sequence 
XXCGCTGGAGATACTTTAATCCAGCATGTGAATATCTTGGTGACTTCAGGATCATTGATACCCAGCTTAGTTAAATGCTTGCTCTTTCGC
CTGGGTGATTTATTCCCTAGCGAAAATGTTTACAGTTCATGGGAAGTGGGCAAGCTCCAGTGCTTTTCATGGATAAAGGAGCGGTTCAAT
GGGCCAAACGTGCAATTTTGTGTTATCGGAGATGGATGGGAAGAATGTGAAGCAGCAGAAAGTATGAGATGGCCATTTGTCAAAATTGAC
CCGCTGCCCAGCAGTTTTCATCGGTTTCCAGGCTTAACACCAAAGGATCTGGGCCACTACTTCTCCGTTGTGTATGGTAATGCTGACGAA
AAAGATAACTAA
Edits in Original Sequence 
(5')XXCGCTGGAGATACTTTAATCCAGCATGTGAATATCTTGGTGACTTCAGGATCATTGATACCCAGCTTAGTTAAATGCTTGCTCTT
TCGCCTGGGTGATTTATTCCCTAGCGAAAATGTTTACAGTTCATGGGAAGTGGGCAAGCTCCAGTGCTTTTCATGGATAAAGGAGCGGTT
CAATGGGCCAAACGTGCAATTTTGTGTTATCGGAGATGGATGGGAAGAATGTGAAGCAGCAGAAAGTATGAGATGGCCATTTGTCAAAAT
TGACCCGCTGCCCAGCAGTTTTCATCGGTTTCCAGGCTTAACACCAAAGGATCTGGGCCACTACTTCTCCGTTGTGTATGGTAATGCTGA
CGAAAAAGATAACTAA(3')TATACTAGCTCCTTCTGGCAATTGATCATGTTAATAGGTAGCTTACTGAGAAACTTCAGTTCATGCATCA
ATAGCTTTTTCACCAACAAAGTCACTTTGACATAAACTGGTGAAGGCTCTTTATAAAAAAAGTCATTTTTGCAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan