ESTScan Details for Unigene SGN-U601814

Score 
253
Direction 
Forward
Predicted Peptide Sequence 
XKIYHQMDDLGTPRSAISFNXAFISLRGSKLYDRVPQLFDEIPVKYRFLPDKVSYGILIRSYCETGLPEMAMEILKVMEEKSVEITTVTF
TTILHSFYKKGKSDEAEKVWNEMVNRGCGPDVGAYNVKIMNIQGGDLEGVKALIEEMNDAGLKPDTISYNYLMTCYCKNELMDEAQMVYD
DLX
Predicted Coding Sequence 
XTCAAAATTTATCATCAGATGGATGATTTAGGCACCCCCAGATCAGCTATTTCCTTCAATGXTGCTTTTATCAGCTTGCGTGGCTCAAAA
CTATATGATCGTGTCCCCCAGCTGTTTGATGAAATTCCAGTGAAGTATAGATTTTTACCTGATAAAGTGTCGTACGGTATACTGATTAGG
TCATATTGTGAAACGGGGTTGCCGGAAATGGCAATGGAAATACTCAAGGTGATGGAGGAGAAAAGTGTGGAGATTACAACGGTTACTTTC
ACTACTATACTACATTCATTCTACAAGAAAGGGAAGAGTGATGAGGCGGAGAAGGTATGGAATGAGATGGTGAACAGAGGGTGTGGTCCA
GATGTTGGTGCATACAATGTGAAGATTATGAACATTCAGGGGGGTGATCTGGAGGGCGTGAAAGCTTTAATTGAGGAAATGAACGATGCT
GGATTGAAACCTGATACGATTAGCTACAATTATTTGATGACTTGTTATTGTAAGAATGAATTGATGGACGAGGCACAGATGGTTTATGAT
GATCTGGXX
Edits in Original Sequence 
(5')XTCAAAATTTATCATCAGATGGATGATTTAGGCACCCCCAGATCAGCTATTTCCTTCAATGXTGCTTTTATCAGCTTGCGTGcGCT
CAAAACTATATGATCGTGTCCCCCAGCTGTTTGATGAAATTCCAGTGAAGTATAGATTTTTACCTGATAAAGTGTCGTACGGTATACTGA
TTAGGTCATATTGTGAAACGGGGTTGCCGGAAATGGCAATGGAAATACTCAAGGTGATGGAGGAGAAAAGTGTGGAGATTACAACGGTTA
CTTTCACTACTATACTACATTCATTCTACAAGAAAGGGAAGAGTGATGAGGCGGAGAAGGTATGGAATGAGATGGTGAACAGAGGGTGTG
GTCCAGATGTTGGTGCATACAATGTGAAGATTATGAACATTCAGGGGGGTGATCTGGAGGGCGTGAAAGCTTTAATTGAGGAAATGAACG
ATGCTGGATTGAAACCTGATACGATTAGCTACAATTATTTGATGACTTGTTATTGTAAGAATGAATTGATGGACGAGGCACAGATGGTTT
ATGATGATCTGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan