ESTScan Details for Unigene SGN-U602370

Score 
184
Direction 
Reverse
Predicted Peptide Sequence 
XHNEEVSFVGTNISEAYLDWRLFVDGAANHQGKGIGAVLVSNSGQHYPMEEKLQFNYTNNMAEYEACIQVFKWPSDMNVHELLVISDSDL
LIYEVQGEWAVKNPKIIAYMQHVQNYARDFVGSSLDXTPRIQNVLADALATIASMIKHLDIDYIDLVDIELKEHPVHCSHVEAEQEGLCW
YSDIKNIWGXGIYLEVATLSGEVLYSITPYLGLP*
Predicted Coding Sequence 
XTTCATAATGAAGAAGTGTCATTCGTGGGTACAAATATTTCTGAAGCATATCTCGACTGGAGACTATTCGTTGATGGAGCGGCGAATCAT
CAAGGGAAAGGCATCGGAGCGGTTTTAGTGTCAAATTCTGGTCAACACTATCCCATGGAAGAAAAACTCCAATTTAATTACACGAACAAC
ATGGCTGAGTATGAAGCTTGTATCCAGGTTTTTAAATGGCCATCXGACATGAATGTCCACGAGTTGTTGGTTATTTCAGATTCAGATCTT
TTGATTTATGAAGTTCAAGGAGAATGGGCTGTGAAGAACCCGAAGATTATAGCTTACATGCAGCATGTACAGAACTATGCAAGAGATTTC
GTAGGATCGAGTTTAGACATXACTCCTAGAATACAAAATGTGTTAGCTGATGCCCTTGCCACTATCGCTTCAATGATCAAACATCTAGAC
ATTGATTATATTGATCTTGTTGATATAGAGCTAAAAGAACACCCAGTCCATTGTTCACATGTTGAGGCAGAACAAGAAGGATTGTGTTGG
TACTCTGATATAAAAAATATTTGGGGTXCTGGTATTTATCTAGAAGTTGCTACTCTAAGTGGAGAAGTTCTTTATAGTATAACTCCATAT
TTGGGTCTCCCTTGA
Edits in Original Sequence 
(5')XTTCATAATGAAGAAGTGTCATTCGTGGGTACAAATATTTCTGAAGCATATCTCGACTGGAGACTATTCGTTGATGGAGCGGCGAA
TCATCAAGGGAAAGGCATCGGAGCGGTTTTAGTGTCAAATTCTGGTCAACACTATCCCATGGAAGAAAAACTCCAATTTAATTACACGAA
CAACATGGCTGAGTATGAAGCTTGTATCCAcGGTTTTTAAATGGCCATCXGACATGAATGTCCACGAGTTGTTGGTTATTTCAGATTCAG
ATCTTTTGATTTATGAAGTTCAAGGAGAATGGGCTGTGAAGAACCCGAAGATTATAGCTTACATGCAGCATGTACAGAACTATGCAAGAG
ATTTCGTAGGATCGAGTTTAGACATXACTCCTAGAATACAAAATGTGTTAGCTGATGCCCTTGCCACTATCGCTTCAATGATCAAACATC
TAGACATTGATTATATTGATCTTGTTGATATAGAGCTAAAAGAACACCCAGTCCATTGTTCACATGTTGAGGCAGAACAAGAAGGATTGT
GTTGGTACTCTGATATAAAAAATATTTGGGGTXCTGGTATTTATCTAGAAGTTGCTACaTCTAAGTGGAGAAGTTCTTTATAGTATAACT
CCATATTTGGGTCTCCCTTGA(3')TGCGTCGATACTGTTAAAGTTGTGAAGCTTGTCGAATAAGTACATGCGGGAGTTTATGAAACGCA
TATGAATATGTTCACTTAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan