ESTScan Details for Unigene SGN-U602686

Score 
324
Direction 
Forward
Predicted Peptide Sequence 
VNGLCKLKTSDDVMETFKXHGGKRVRPKYNPYNILIESLCKSRKLMKALELLEDIQNRGLIPDTVSCGTLINGFCENEDLDGAYELFRRM
RRQYKYFHTTATYNIMISAFSKKLKMDMADKLFLEMNECGCPPDSYTYRCMIDGFCKVDNTEFGYKFLLENFSKELLPSKETAGQVINX
Predicted Coding Sequence 
GTGAATGGACTTTGCAAGCTTAAAACTTCTGATGATGTGATGGAAACCTTCAAAGXTCATGGTGGAAAAAGGGTGCGTCCCAAATATAAT
CCATATAATATACTCATTGAAAGCCTCTGTAAATCTAGAAAGCTTATGAAAGCTTTAGAATTACTTGAGGATATTCAAAACAGGGGTCTT
ATTCCTGATACAGTGAGTTGTGGCACTCTGATAAATGGGTTTTGTGAGAATGAGGATTTGGATGGAGCTTATGAGCTATTCAGAAGAATG
AGAAGGCAATATAAGTATTTTCATACTACTGCAACATACAATATAATGATCAGTGCATTTTCTAAAAAGCTGAAAATGGACATGGCAGAT
AAGCTTTTTCTTGAGATGAATGAATGTGGCTGTCCTCCTGACAGCTACACATACCGTTGTATGATAGATGGTTTCTGCAAGGTCGACAAT
ACTGAATTTGGATACAAGTTTTTGCTTGAAAACTTTTCGAAAGAACTTCTTCCATCAAAAGAAACAGCGGGACAAGTGATCAATTGX
Edits in Original Sequence 
(5')GTGAATGGACTTTGCAAGCTTAAAACTTCTGATGATGTGATGGAAACCTTCAAAGXTCATGGTGGAAAAAGGGTGCGTCCCAAATA
TAATCaCATATAATATACTCATTGAAAGCCTCTGTAAATCTAGAAAGCTTATGAAAGCTTTAGAATTACTTGAGGATATTCAAAACAGGG
GTCTTATTCCTGATACAGTGAGTTGTGGCACTCTGATAAATGGGTTTTGTGAGAATGAGGATTTGGATGGAGCTTATGAGCTATTCAGAA
GAATGAGAAGGCAATATAAGTATTTTCATACTACTGCAACATACAATATAATGATCAGTGCATTTTCTAAAAAGCTGAAAATGGACATGG
CAGATAAGCTTTTTCTTGAGATGAATGAATGTGGCTGTCCTCCTGACAGCTACACATACCGTTGTATGATAGATGGTTTCTGCAAGGTCG
ACAATACTGAATTTGGATACAAGTTTTTGCTTGAAAACTTTTCGAAAGAACTTCTTCCATCAAAAGAAACAGCGGGACAAGTGATCAATT
GX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan