ESTScan Details for Unigene SGN-U603042

Score 
373
Direction 
Forward
Predicted Peptide Sequence 
XHLSELSLLETIKLGSNCFIGEIPPEFGRLTELKLLDLSGNALTGKIPAQLGQLTKLQVLALGNNLLSGSLSATLFTKLQSLTSFDVSNN
TLSGIIPPEIGELRSLTDLYIGENRFS
Predicted Coding Sequence 
XTTCATCTCAGTGAACTTTCTCTGTTAGAAACAATTAAACTTGGTTCTAACTGTTTTATTGGAGAAATACCGCCGGAGTTTGGACGGTTG
ACGGAGTTGAAGTTACTTGACCTTTCCGGCAATGCACTGACCGGAAAAATTCCAGCACAACTTGGTCAGCTTACTAAGCTACAAGTCTTG
GCACTTGGAAATAACCTTCTTTCTGGTTCTTTATCTGCAACACTTTTTACAAAGCTTCAATCTTTAACTTCTTTTGATGTTTCTAATAAC
ACCCTTTCTGGTATTATTCCACCTGAAATTGGGGAATTGAGAAGCCTTACTGATCTTTACATTGGGGAAAACAGATTCTCX
Edits in Original Sequence 
(5')XTTCATCTCAGTGAACTTTCTCTGTTAGAAACAATTAAACTTGGTTCTAACTGTTTTATTGGAGAAATACCGCCGGAGTTTGGACG
GTTGACGGAGTTGAAGTTACTTGACCTTTCCGGCAATGCACTGACCGGAAAAATTCCAGCACAACTTGGTCAGCTTACTAAGCTACAAGT
CTTGGCACTTGGAAATAACCTTCTTTCTGGTTCTTTATCTGCAACACTTTTTACAAAGCTTCAATCTTTAACTTCTTTTGATGTTTCTAA
TAACACCCTTTCTGGTATTATTCCACCTGAAATTGGGGAATTGAGAAGCCTTACTGATCTTTACATTGGGGAAAACAGATTCTCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan