ESTScan Details for Unigene SGN-U603293

Score 
299
Direction 
Forward
Predicted Peptide Sequence 
XMNGMELTADVICYTVLIDSHCKSDNIDDAIHLFTEMIDRGLEPDSVTYTALICGYCKQGHVEMAKELVNDMWRKGIQPDSHTISALHHG
IKRPKSCTLGMTITQPKIGDCRLSSVVLARHKFVAMSTYFGNTGKRRVGAPDVTX
Predicted Coding Sequence 
XXAATGAACGGGATGGAATTAACTGCTGATGTCATTTGTTACACTGTTTTGATTGATAGTCACTGTAAATCAGACAACATTGATGATGCT
ATTCACCTTTTCACTGAAATGATTGATAGAGGTTTAGAACCTGATAGTGTGACATACACAGCTCTAATATGTGGCTATTGTAAGCAAGGA
CATGTTGAGATGGCTAAAGAACTTGTGAATGATATGTGGAGAAAGGGAATACAACCAGATAGCCATACCATCTCAGCACTACATCATGGA
ATCAAAAGGCCAAAAAGTTGCACCTTAGGCATGACAATAACTCAGCCCAAAATCGGAGACTGCAGGTTATCTAGTGTAGTTTTGGCAAGG
CACAAGTTTGTTGCXATGAGCACATACTTTGGTAATACTGGAAAGAGAAGAGTTGGTGCTCCTGATGTAACTAXX
Edits in Original Sequence 
(5')XXAATGAACGGGATGGAATTAACTGCTGATGTCATTTGTTACACTGTTTTGATTGATAGTCACTGTAAATCAGACAACATTGATGA
TGCTATTCACCTTTTCACTGAAATGATTGATAGAGGTTTAGAACCTGATAGTGTGACATACACAGCTCTAATATGTGGCTATTGTAAGCA
AGGACATGTTGAGATGGCTAAAGAACTTGTGAATGATATGTGGAGAAAGGGAATACAACCAGATAGCCATACCATCTCAGCACTACATCA
TGGAATCAtAAAGGCCAAAAAGTTGCACCTTAGGCATGACAATAACTCAGCCCAAAATCGGAGACTGCAGGTTATCTAGTGTAGTTTTGG
CAAGGCACAAGTTTGTTGCXATGAGCACATACTTTGGTAATACTGGAAAGAGAAGAGTTGGTGCTCCTGATGTAACTAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan