ESTScan Details for Unigene SGN-U603462

Score 
424
Direction 
Forward
Predicted Peptide Sequence 
MPTISEISSSSSPNSWQLDEDEPIISSSLKIQLVSKSVSERLLSKFSDLTEFGFDYSKSGLWSPPIERCHVFSGSPTGKILSHRQMADKL
NKVLKDIREEDVASMHVYVLQRDSDLKDTLRD*
Predicted Coding Sequence 
ATGCCCACCATATCTGAAATCTCATCTTCATCTTCTCCAAATTCATGGCAATTAGATGAAGACGAACCTATAATTTCTTCTTCATTGAAA
ATTCAATTAGTTTCCAAGTCAGTATCAGAGAGATTGCTCTCTAAATTCTCCGATTTAACTGAATTTGGTTTTGATTACTCTAAAAGTGGA
TTATGGTCTCCTCCAATAGAAAGATGCCACGTGTTCTCCGGCTCACCCACCGGGAAAATCCTTTCACACAGACAAATGGCTGATAAATTG
AATAAAGTATTGAAGGACATCAGAGAAGAAGACGTTGCTTCAATGCATGTTTATGTTCTCCAAAGAGATTCTGATCTCAAAGACACATTG
AGAGACTAA
Edits in Original Sequence 
GATATCATGCATTCCTTTTAATAATATTCTTTCTCTAATAAATCTCTTCTCCTTTTTCTCTCTTTTATTCTTTTTTTCAATTAAAAAAAA
TAAAT
(5')ATGCCCACCATATCTGAAATCTCATCTTCATCTTCTCCAAATTCATGGCAATTAGATGAAGACGAACCTATAATTTCTTCT
TCATTGAAAATTCAATTAGTTTCCAAGTCAGTATCAGAGAGATTGCTCTCTAAATTCTCCGATTTAACTGAATTTGGTTTTGATTACTCT
AAAAGTGGATTATGGTCTCCTCCAATAGAAAGATGCCACGTGTTCTCCGGCTCACCCACCGGGAAAATCCTTTCACACAGACAAATGGCT
GATAAATTGAATAAAGTATTGAAGaGACATCAGAGAAGAAGACGTTGCTTCAATGCATGTTTATGTTCTCCAAAGAGATTCTGATCTCAA
AGACACATTGAGAGACTAA(3')GAAAATATGCAGGAAAGATATTTTGTTTATAATTATTATTATCTAATTCAAAATGTACATGCTTTTT
TTATGTAATTACTATTAATTTATTAATTATATTAGAGGAAAGGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan