ESTScan Details for Unigene SGN-U603510

Score 
220
Direction 
Reverse
Predicted Peptide Sequence 
MKDARTGTAVGLALALAGGVCLLGGAHQTHGEKPKTRIINK**
Predicted Coding Sequence 
ATGAAAGATGCAAGAACAGGCACAGCAGTAGGATTAGCATTAGCATTAGCAGGAGGAGTTTGTTTACTAGGAGGTGCACACCAAACACAT
GGAGAAAAACCCAAAACAAGAATCATAAACAAATAATAA
Edits in Original Sequence 
AAAATTAAATGCCTCAAACAACTCAGCATCCACATCATCAATGCAAAATCCCAAAACCTGGGTGATATCCTTATGGAATACTTTTGTAAG
ATTTGCAAGTTGGCCATAA
(5')ATGAAAGATGCAAGAACAGGCACAGCAGTAGGATTAGCATTAGCATTAGCAGGAGGAGTTTGTTTAC
TAGGAGGTGCACACCAAACACATGGAGAAAAACCCAAAACAAGAATCATAAACAAATAATAA(3')ATGGGTAACCATATCCTAACTTTA
CCCATTTCATCTAATATTCCAAATAAATTAATTCCTAAAGAAGATTAATGCCACCACTAAATAAAACATAAAACTGAATAAACTAAAAAA
TAGAAACAACCCCAAGAAGCCAAAAAGTGGAAATTTTTCAAGGGATGAAGGATATTTTACAAGAAAACTGAAACAACACAAAGAACCAAA
AAGATGATTTTTTTTCTTCAATAAAATGGAAATAGAAACAACCCAAGAACCAAAAAGATGAAATTTTTCAATAGAATAGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan