ESTScan Details for Unigene SGN-U603529

Score 
105
Direction 
Reverse
Predicted Peptide Sequence 
HYAVVDSVSKYKEYITSKVGMMKNDLAEAAGTIADLHKAGLPVSDAXPLIPPDLKYIMFLRFYLKYGYVGTPSLTKVYKCVFHGMVLTID
XDCCCEDLIKFSSDHASHEVDICYFAHLYSSTKSRFRYGTTRNFAD
Predicted Coding Sequence 
CACTATGCTGTTGTTGATTCAGTTTCAAAATATAAAGAGTATATTACATCAAAAGTTGGCATGATGAAGAATGATCTCGCAGAAGCTGCC
GGGACTATAGCAGATCTGCATAAAGCTGGTTTGCCTGTCTCTGACGCAAAXCCACTGATTCCTCCTGATCTTAAGTACATTATGTTTCTT
CGTTTTTACTTAAAATATGGTTATGTTGGTACACCATCCCTTACAAAGGTCTACAAGTGTGTATTCCATGGTATGGTCTTAACAATTGAT
XTAGACTGTTGCTGTGAAGATCTCATTAAGTTCTCGTCTGATCATGCTAGTCACGAAGTTGACATTTGTTATTTTGCCCACTTGTATAGT
AGCACAAAATCCAGATTCAGATATGGAACCACAAGAAACTTTGCTGAC
Edits in Original Sequence 
(5')CACTATGCTGTTGTTGATTCAGTTTCAAAATATAAAGAGTATATTACATCAAAAGTTGGCATGATGAAGAATGATCTCGCAGAAGC
TGCCGGGACTATAGCAGATCTGCATAAAGCTGGTTTGCCTGTCTCTGACGCAAAXCCACTGATTCCTCCTGATCTTAAGTACATTATGTT
TCTTCGTTTTTACTTAAAATATGGTTATGTTGGTACACCATCCCTTACAAAGGTCTACAAGTGTGTATTCCATGGTATGGTCTTAACAAT
TGATXTAGACTGTTGCTGTGAAGATCTCATTAAGTTCTCGTCTGATCATGCTAGTCACGAAGTTGACATTTGTTATTTTGCCCACTTGTA
TAGTAGCACAAAATCCAGATTCAGATATGGAACCACAAGAAACTTTGCTGAC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan