ESTScan Details for Unigene SGN-U603765

Score 
216
Direction 
Reverse
Predicted Peptide Sequence 
DLLSYNNVLGLCATDGRYKEALATYKEMLFFAIQPDDSTFKSLGIVFFKCGVPKEVINKLEFMRKKDPQSGVQEWNSALSSVIGVLDTDF
PDSKDA*
Predicted Coding Sequence 
GACTTGTTGAGTTACAACAATGTGCTTGGATTGTGTGCAACTGATGGGAGGTATAAAGAAGCTTTGGCTACTTACAAGGAAATGCTTTTT
TTTGCCATCCAACCTGATGATTCAACATTCAAATCACTCGGAATTGTTTTTTTTAAATGCGGTGTTCCAAAGGAGGTTATTAATAAGCTG
GAATTTATGAGGAAAAAGGATCCTCAGAGTGGCGTGCAAGAGTGGAATTCAGCCCTATCTTCCGTTATCGGTGTGCTTGATACTGACTTT
CCTGATAGTAAAGATGCCTAG
Edits in Original Sequence 
(5')GACTTGTTGAGTTACAACAATGTGCTTGGATTGTGTGCAACTGATGGGAGGTATAAAGAAGCTTTGGCTACTTACAAGGAAATGCT
TTTTTTTGCCATCCAACCTGATGATTCAACATTCAAATCACTCGGAATTGTTTTTTTTAAATGCGGTGTTCCAAAGGAGGTTATTAATAA
GCTGGAATTTATGAGGAAAAAGGATCCTCAGAGTGGCGTGCAAGAGTGGAATTCAGCCCTATCTTCCGTTATCGGTGTGCTTGATACTGA
CTTTCCTGATAGTAAAGATGCCTAG(3')TTTTTTTTAATTATGGTTTTACGATAGGAGATGATTATATGTACCGTTTAAAAAAAGGATA
GGAGATTGCACCATGGGGGTGGGTTTACAGAGATTAAACTTTATACGAGCACTTTTTCAAAGAGAAGCTGCTTCATACTTTATTGACACA
GGTAGATTTTACTTAAGTGGCTCAAGCCTTTCATGTATTTTTCACAATTTTTTTGTTGTAAATACAAATATGTATTAAAAGTTTGCCAGA
TTTAGGCATTATTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan