ESTScan Details for Unigene SGN-U604276

Score 
468
Direction 
Forward
Predicted Peptide Sequence 
MLAKLEKFKAGLSAKANESANAVKEEELSDWAAVTLKFTPEPGKDKMSRSEDPNDYVVHDPLLEKGKEKFNKMMAKQNDEKENGLANLLL
ELIFQLKKDGIATVKLFGIHFGGWAGKSLT*
Predicted Coding Sequence 
ATGCTAGCAAAATTGGAGAAATTTAAGGCTGGACTGTCTGCTAAAGCCAATGAATCTGCTAATGCTGTCAAGGAGGAAGAATTATCTGAT
TGGGCAGCAGTTACATTAAAATTCACTCCTGAACCTGGAAAGGACAAAATGTCTCGTAGTGAGGACCCCAATGATTACGTGGTACACGAT
CCTTTGTTGGAGAAAGGGAAAGAGAAGTTCAATAAAATGATGGCAAAGCAAAACGACGAGAAAGAGAATGGGCTGGCAAATCTCTTACTT
GAGCTGATCTTCCAGCTGAAGAAAGACGGAATCGCTACTGTGAAATTATTCGGCATTCATTTTGGAGGCTGGGCTGGCAAATCTCTTACT
TGA
Edits in Original Sequence 
GCATTTTTGAGATGTTATTTAACATCTCAAGGGGGAAGAGAATACTTGAAATAATGTTTTATGTAAATTCTAGTATGTTGGAAAATGTTG
AGTTTTCATGGTAATTATTAGAAGACATTAATTAGATTCATTCTGACTTAACTTTGGACTTGTGTGGAAAGGATATTTGTGCTTTGTTCC
AAGCAACTTTGCAGGTAACCATTATTTGTATTTCTGCTAG
(5')ATGCTAGCAAAATTGGAGAAATTTAAGGCTGGACTGTCTGCTAAAG
CCAATGAATCTGCTAATGCTGTCAAGGAGGAAGAATTATCTGATTGGGCAGCAGTTACATTAAAATTCACTCCTGAACCTGGAAAGGACA
AAATGTCTCGTAGTGAGGACCCCAATGATTACGTGGTACACGATCCTTTGTTGGAGAAAGGGAAAGAGAAGTTCAATAAAATGATGGCAA
AGCAAAAgCGACGAGAAAGAGAATGGGCTGGCAAATCTCTTACTTGAGCTGATCTTCCAGCTGAAGAAAcGACGGAATCGCTACTGTGAA
ATTATTCGGCATTCATTTTGGAGGCTGGGCTGGCAAATCTCTTACTTGA(3')GCTGATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan