ESTScan Details for Unigene SGN-U605890

Score 
656
Direction 
Forward
Predicted Peptide Sequence 
XGSLLQARLNRVKQNAGEKSKEKPAESQXQLVCSTFELPRILQNHDGGSLGFLLRYLVNISANLPHHFRKSYASVSALSMAKAKFQLPKQ
RKFSTGHRNPSFSWMATVGENVQSNASAAAPPPTSVPVRVAHELLQAGHRYLDVRTAEEFSAGHAAGAVNVPYMFRVGSGMIKNLNFVEE
VLAIFGKDDEIIVGCQLGKRSLMAATDLISAGFTGITDIAGGYAAWVQNELPDRVVMTMEEGNTGCDA*
Predicted Coding Sequence 
XXAGGGTCTCTTCTCCAAGCTAGACTAAACAGAGTAAAACAAAACGCTGGTGAAAAGAGCAAAGAAAAACCAGCAGAGTCACAAGAXCAG
CTAGTTTGTTCAACATTTGAACTTCCTCGTATACTTCAAAACCATGATGGGGGCTCTCTCGGTTTCCTCCTCCGCTACCTTGTCAACATT
TCTGCTAATCTTCCGCACCATTTCAGGAAAAGCTATGCATCAGTCTCAGCGCTATCAATGGCCAAGGCTAAGTTTCAACTCCCGAAACAA
CGCAAGTTCAGCACTGGCCACAGAAATCCCAGCTTCAGTTGGATGGCTACTGTTGGAGAGAATGTTCAATCAAATGCATCAGCAGCAGCA
CCACCACCAACATCAGTCCCGGTTCGTGTAGCTCACGAGCTGCTTCAGGCAGGCCATCGTTATTTAGATGTCAGGACTGCTGAAGAATTC
AGTGCTGGTCATGCTGCTGGGGCTGTCAATGTGCCTTACATGTTTAGAGTTGGATCAGGTATGATTAAAAACCTGAACTTCGTGGAGGAA
GTTTTAGCAATTTTTGGGAAAGATGACGAAATTATTGTTGGCTGCCAATTGGGGAAAAGGTCATTGATGGCTGCAACTGATCTTATATCC
GCTGGGTTTACTGGCATTACAGACATTGCAGGTGGATATGCTGCCTGGGTACAGAATGAACTTCCXGACAGAGTCGTGATGACTATGGAG
GAGGGGAACACGGGTTGTGACGCTTAA
Edits in Original Sequence 
(5')XXAGGGTCTCTTCTCCAAGCTAGACTAAACAGAGTAAAACAAAACGCTGGTGAAAAGAGCAAAGAAAAACCAGCAGAGTCACAAGA
XCAGCTAGTTTGTTCAACATTTGAACTTCCTCGTATACTTCAAAACCATGATGGGGGCTCTCTCGGTTTCCTCCTCCGCTACCTTGTCAA
CATTTCTGCgTAATCTTCCGCACCATTTCAGGAAAAGCTATGCATCAGTCTCAGCGCTATCAATGGCCAAGGCTAAGTTTCAACTCCCGA
AACAACGCAAGTTCAGCACTGGCCACAGAAATCCCAGCTTCAGTTGGATGGCTACTGTTGGAGAGAATGTTCAATCAAATGCATCAGCAG
CAGCACCACCACCAACATCAGTCCCGGTTCGTGTAGCTCACGAGCTGCTTCAGGCAGGCCATCGTTATTTAGATGTCAGGACTGCTGAAG
AATTCAGTGCTGGTCATGCTGCTGGGGCTGTCAATGTGCCTTACATGTTTAGAGTTGGATCAGGTATGATTAAAAACCTGAACTTCGTGG
AGGAAGTTTTAGCAATTTTTGGGAAAGATGACGAAATTATTGTTGGCTGCCAATTGGGGAAAAGGTCATTGATGGCTGCAACTGATCTTA
TATCCGCTGGGTTTACTGGCATTACAGACATTGCAGGTGGATATGCTGCCTGGGTACAGAATGAACTTCCXGACAGAGTCGTGATGACTA
TGGAGGAGGGGAACACGGGTTGTGACGCTTAA(3')TAACACAGGCTATGTACAGCGTTAGATTATGCAAAATAATTTTTTTAAAAAATA
AAAAATAAAAAATAAAAACTGGCTGTGTACTGACTTTACAAGCAGGGAGAAAAGGCAATGTCAAACAATTAAAACGGAAGTTGTACAGCA
ATAGGATTCCGAAGCTATAGACATCTCCATTACTTGATACCACGGCACCTAAGCCATACTCTGCATTAATGTTGAAGCTTGTCAGACAGC
CAAAGTTTGAATTGTCAAAATAGCTCAGTTTTAAAATTTGTTGTTTTGTGTATGAAAATAGGAAAAAACATATGATGTTGAATGAACATA
GGTAAAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan