Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U613088

Score 
822
Direction 
Forward
Predicted Peptide Sequence 
AEFFISQIVRISRRIPVSHAYIKRESFVNQLSSAYTNFSFDSGEHSLSQRFASGRLKFDLGGEKSGNENRIFVSVLQGFWVFRMAIRGVD
FKWYDGFFLSMLATSIIIVAINWKRYHLCTYPLHIWIVADYTTVFVFRLLMFVDNGLAAGMGLDFGPQQRHARFCGRTVVLSILAXVALS
LSLGLDYYWDPMVHQCQKLLARRRPEMGLSNLVALQLLRTCLHTLHVNGKVVDEKESTSITAQQGIPISEFGVLVDMIRVPDWAFEAAGQ
EMRGMGQDAAAYQPGLYLTPAQREAVEALIQELPKFRLKAAPTDCSECPICLEEFHVGNEVRGLPCAHNFHVECIDEWLRLNVKCPRCRC
SVFPNLDLSALSNIRADSERSSSHVVTTTPYVRTQPSSQRYLLRLQGLLRPIRTENAEPVAEADIALETAENGRMAVATQGPADSEAVEV
LVEPSSHQQSPEFAFNHSNPX
Predicted Coding Sequence 
GCCGAATTTTTCATCTCTCAAATAGTCCGTATCTCTCGTAGAATTCCCGTATCCCATGCGTATATCAAACGCGAGTCATTCGTTAATCAG
CTCTCTTCTGCTTATACGAACTTTTCTTTTGATTCCGGGGAACACTCACTGAGCCAGAGATTCGCTTCTGGACGGCTCAAATTTGATTTG
GGTGGTGAAAAATCAGGAAATGAGAATCGAATCTTTGTCTCAGTCTTGCAGGGTTTCTGGGTTTTTCGAATGGCGATCAGAGGTGTCGAT
TTTAAGTGGTATGATGGATTCTTTTTGTCAATGCTAGCTACTAGTATAATAATTGTGGCAATCAATTGGAAGAGATACCATCTCTGTACA
TACCCCTTGCACATATGGATTGTGGCTGACTACACAACTGTATTTGTATTTCGGCTACTGATGTTTGTAGATAATGGCCTTGCTGCTGGA
ATGGGATTGGATTTTGGTCCACAGCAGAGACATGCTCGTTTCTGTGGAAGAACAGTAGTTCTCTCAATTCTTGCTXCTGTTGCTTTATCC
CTTTCTCTGGGTCTGGACTATTATTGGGACCCTATGGTTCACCAGTGCCAGAAACTGCTTGCCAGAAGAAGGCCAGAAATGGGGCTTTCT
AATTTGGTTGCTCTTCAGCTACTGCGGACTTGTTTGCATACCTTGCATGTCAATGGGAAAGTGGTTGACGAGAAGGAAAGCACATCTATT
ACTGCTCAACAGGGCATACCAATTTCAGAATTTGGAGTTTTGGTTGACATGATCCGGGTGCCAGATTGGGCTTTTGAAGCAGCTGGCCAA
GAAATGCGGGGAATGGGCCAAGATGCTGCTGCATATCAACCTGGACTTTACTTGACTCCTGCTCAGAGAGAAGCTGTTGAGGCACTCATT
CAGGAACTCCCAAAGTTCAGGTTGAAGGCTGCTCCAACTGATTGCAGTGAGTGCCCTATTTGTCTAGAAGAGTTCCATGTTGGCAATGAG
GTTAGAGGCCTTCCATGTGCTCACAACTTCCATGTAGAATGCATTGATGAATGGCTTCGGCTTAATGTTAAATGCCCTAGATGTCGTTGC
TCCGTTTTTCCAAACCTTGACCTTAGTGCACTATCCAACATTCGTGCTGATTCAGAACGATCATCTTCTCATGTTGTAACAACCACCCCG
TATGTAAGAACTCAACCATCTAGCCAGAGATATCTGCTGAGATTACAAGGGCTTCTCCGCCCAATTCGCACAGAAAATGCAGAACCTGTC
GCTGAGGCAGATATTGCTCTGGAAACTGCTGAAAATGGAAGAATGGCTGTTGCAACTCAAGGCCCAGCAGATTCAGAAGCTGTAGAAGTG
CTGGTTGAACCCTCCTCCCATCAGCAATCACCAGAGTTCGCTTTTAACCACTCTAACCCCCXX
Edits in Original Sequence 
(5')GCCGAATTTTTCATCTCTCAAATAGTCCGTATCTCTaCGTAGAATTCCCGTATCCCATGCGTATATCAAACGCGtAGTCATTCGTT
AATCAGCTCTCTTCTGCTTATACGAACTTTTCTTTTGATTCCGGGGAACACTCACTGAGCCAGAGATTCGCTTCTGGACGGCTCAAATTT
GATTTGGGTGGTGAAAAATCAGGAAATGAGAATCGAATCTTTGTCTCAGTCTTGCtAGGGTTTCTGGGTTTTTCGAATGGCGATCAGAGG
TGTCGATTTTAAGTGGTATGATGGATTCTTTTTGTCAATGCTAGCTACTAGTATAATAATTGTGGCAATCAATTGGAAGAGATACCATCT
CTGTACATACCCCTTGCACATATGGATTGTGGCTGACTACACAACTGTATTTGTATTTCGGCTACTGATGTTTGTAGATAATGGCCTTGC
TGCTGGAATGGGATTGGATTTTGGTCCACAGCAGAGACATGCTCGTTTCTGTGGAAGAACAGTAGTTCTCTCAATTCTTGCTXCTGTTGC
TTTATCCCTTTCTCTGGGTCTGGACTATTATTGGGACCCTATGGTTCACCAGTGCCAGAAACTGCTTGCCAGAAGAAGGCCAGAAATGGG
GCTTTCTAATTTGGTTGCTCTTCAGCTACTGCGGACTTGTTTGCATACCTTGCATGTCAATGGGAAAGTGGTTGACGAGAAGGAAAGCAC
ATCTATTACgTGCTCAACAGGGCATACCAATTTCAGAATTTGGAGTTTTGGTTGACATGATCCGGGTGCCAGATTGGGCTTTTGAAGCAG
CTGGCCAAGAAATGCGGGGAATGGGCCAAGATGCTGCTGCATATCAACCTGGACTTTACTTGACTCCTGCTCAGAGAGAAGCTGTTGAGG
CACTCATTCAGGAACTCCCAAAGTTCAGGTTGAAGGCTGCTCCAACTGATTGCAGTGAGTGCCCTATTTGTCTAGAAGAGTTCCATGTTG
GCAATGAGGTTAGAGGCCTTCCATGTGCTCACAACTTCCATGTAGAATGCATTGATGAATGGCTTCGGCTTAATGTTAAATGCCCTAGAT
GTCGTTGCTCCGTTTTTCCAAACCTTGACCTTAGTGCACTATCCAACATTCGTGCTGATTCAGAACGATCATCTTCTCATGTTGTAACAA
CCACCCCGTATGTAAGAACTCAACCATCTAGCCAGAGATATCTGCTGAGATTACAAGGGCTTCTCCGCCCAATTCGCACAGAAAATGCAG
AACCTGTCGCTGAGGCAGATATTGCTCTGGAAACTGCTGAAAATGGAAGAATGGCTGTTGCAACTCAAGGCCCAGCAGATTCAGAAGCTG
TAGAAGTGCTGGTTGAACCCTCCTCCCATCAGCAATCACCAGAGTTCGCTTTTAACCACTCTAACCCCCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan