ESTScan Details for Unigene SGN-U613103

Score 
822
Direction 
Forward
Predicted Peptide Sequence 
MSQNAGEKSNRKNKNKRERIFHSIXPKLLDFSSVSYPIAVXMMDPNPKPNPKPEDHPHSADYAPYPKLDTQDITPPPPTTTDTWTSVPVG
SDPPPPSSQPPQGPNPQTEPASYTAAPRSPQAPPPPAAHPLPGASAATSMPPESNPYVSPAPAGGSGSSVKNTVDSVKDVLGKWGKKAAE
ATKKGQDLAGNMWQHLKTGPSMADAAVGRIAQGTKIFAEGGYEKVFKQTFETAPEEKLLKYYACYLSTSAGPVMGVLYLSTAKLAFSSDN
PLSYKVGEETQWSYYKVVIPLHQLKAVNSSTSKINSAENQPEASRTVGLPXLAVSSGMVGHAALFGCTTV*
Predicted Coding Sequence 
ATGTCCCAAAACGCCGGGGAAAAGAGTAACAGAAAAAACAAAAACAAGAGAGAGAGAATCTTTCATTCAATTGAXCCAAAGCTTCTCGAT
TTTTCCTCCGTCTCATACCCAATAGCCGTTGAXATGATGGATCCCAACCCAAAACCCAACCCGAAACCCGAAGATCATCCTCACTCCGCC
GACTACGCTCCGTACCCGAAACTCGATACCCAAGACATAACTCCCCCTCCTCCCACCACTACCGACACCTGGACCTCCGTTCCTGTCGGG
TCGGATCCTCCTCCTCCCTCGTCCCAACCACCGCAAGGTCCAAACCCACAAACAGAACCGGCGTCGTATACTGCTGCTCCCAGGTCTCCC
CAAGCTCCACCACCACCTGCAGCTCATCCCCTCCCCGGCGCCTCTGCTGCAACCTCCATGCCACCTGAATCCAACCCCTACGTCTCTCCC
GCTCCCGCCGGTGGCTCCGGGTCTTCGGTTAAAAATACGGTGGACTCCGTAAAGGATGTGCTGGGGAAATGGGGAAAGAAGGCAGCAGAA
GCCACGAAAAAGGGCCAGGATCTGGCTGGGAACATGTGGCAACATCTAAAAACAGGCCCAAGTATGGCTGATGCGGCTGTTGGAAGAATA
GCTCAGGGAACAAAGATCTTTGCCGAAGGTGGTTATGAGAAAGTATTCAAACAAACATTTGAGACGGCCCCAGAAGAGAAACTTCTTAAA
TACTACGCCTGTTACCTGTCTACATCTGCTGGTCCTGTCATGGGAGTCCTCTATTTGTCAACTGCAAAGCTAGCATTTTCAAGTGATAAT
CCCCTTTCTTATAAAGTTGGTGAGGAGACTCAATGGAGCTATTATAAGGTGGTTATCCCGTTGCATCAGCTGAAAGCAGTTAATTCTTCA
ACAAGTAAAATCAATTCAGCTGAGAATCAGCCTGAGGCCAGTAGAACTGTGGGACTTCCTGXACTAGCAGTCAGTAGCGGGATGGTAGGC
CATGCTGCTCTCTTTGGTTGCACTACTGTATAA
Edits in Original Sequence 
GCTTCTTTGTTTCCTCTGTCTTTTAACTCTTTAAAGTCCCCCGGCGGAGCAGATGTATACATATATTTGATCCTCGTCGACGATCACGAA
GAATTTCAAAT
(5')ATGTCCCAAAACgGCCGGGGAAAAGAGTAACAGAAAAAACAAAAACAAGAGAGAGAGAATCTTTCATTCAATTGA
XCCAAAGCTTCTCGATTTTTCCTCCGTCTCATACCCAATAGCCGTTGAXATGATGGATCCCAACCCAAAACCCAACCCGAAACCCGAAGA
TCATCCTCACTCCGCCGACTACGCTCCGTACCCGAAACTCGATACCCAAGACATAACTCCCCCTCCTCCCACCACTACCGACACCTGGAC
CTCCGTTCCTGTCGGGTCGGATCCTCCTCCTCCCTCGTCCCAACCACCGCAAGGTCCAAACCCACAAACAGAACCGGCGTCGTATACTGC
TGCTCCCAGGTCTCCCCAAGCTCCACCACCACCTGCAGCTCATCCCCTCCCCGGCGCCTCTGCTGCAACCTCCATGCCACCTGAATCCAA
CCCCTACGTCTCTCCCGCTCCCGCCGGTGGCTCCGGGTCTTCGGTTAAAAATACGGTGGACTCCGTAAAGGATGTGCTGGGGAAATGGGG
AAAGAAGGCAGCAGAAGCCACGAAAAAGGGCCAGGATCTGGCTGGGAACATGTGGCAACATCTAAAAACAGGCCCAAGTATGGCTGATGC
GGCTGTTGGAAGAATAGCTCAGGGAACAAAGATCTTTGCCGAAGGTGGTTATGAGAAAGTATTCAAACAAACATTTGAGACGGCCCCAGA
AGAGAAACTTCTTAAATACTACGCCTGTTACCTGTCTACATCTGCTGGTCCTGTCATGGGAGTCCTCTATTTGTCAACTGCAAAGCTAGC
ATTTTCAAGTGATAATCCCCTTTCTTATAAAGTTGGTGAGGAGACTCAATGGAGCTATTATAAGGTGGTTATCCCGTTGCATCAGCTGAA
AGCAGTTAATTCTTCAACAAGTAAAATCAATTCAGCTGAGAATCAGCCTGAGGCCAGTAGAACTGTGGGACTTCCTGXACTAGCAGTCAG
TAGCGGGATGGTAGGCCATGCTGCaTCTCTTTGGTTGCACTACTGTATAA(3')ATGAATTTTGGTCAGTTGTGGCGATGTTGGGAATTG
TGTACTGTGTTCTTGTTTGGTGTGTTGTAACCAGGCTGTGCAAAATTCAAACTGAGATTTGTTCAATTAGTTTTGACTTTTCCAATTTGT
GAGACTTCCAGATAAAATAAACATGTTATTATGCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan