ESTScan Details for Unigene SGN-U613435

Score 
536
Direction 
Forward
Predicted Peptide Sequence 
XRQRSTIPGISRPTAXLSLNQPSAKTTNASAAAAASETLKVAFAAGGTGGHISPAVAIADELKNQNPDIQILFIGTPTGMESAAVPFAGY
PFVAIPAAPLARPLISVHNIFILPFLXDKIPRQKLPNPSRVQPTNSNGTGGYVSFPICLAAAMKGLKLVIQEQNSVPGIANWVLSLFAEK
VFVAFNSSVDCFWQRNKCIVCGNPVRFSLSKNVVKADARKHFFPKAVKGTGKGQGKEFWVLGGSX
Predicted Coding Sequence 
XCGAGGCAACGCTCCACTATTCCAGGAATTTCAAGACCAACAGCTGXTCTTTCTCTCAATCAACCTAGTGCAAAAACCACCAATGCCTCA
GCAGCGGCAGCCGCCTCAGAAACTCTCAAAGTTGCATTCGCCGCCGGTGGGACCGGAGGCCACATATCCCCCGCTGTGGCAATTGCAGAT
GAGCTTAAAAACCAAAACCCTGACATCCAAATCCTCTTCATAGGCACCCCGACCGGGATGGAAAGCGCCGCCGTCCCCTTCGCCGGCTAC
CCATTTGTCGCCATCCCGGCAGCCCCTTTAGCCCGCCCTTTAATCTCTGTTCACAACATCTTCATCCTTCCTTTCCTTCXTGACAAAATC
CCTCGTCAAAAGCTTCCAAACCCTTCAAGAGTTCAGCCCACAAATAGTAATGGCACTGGTGGCTATGTTTCTTTCCCCATTTGCCTAGCT
GCAGCAATGAAAGGTTTAAAATTGGTAATACAAGAGCAAAATTCAGTTCCTGGAATTGCAAATTGGGTGCTTTCTTTATTTGCTGAGAAA
GTTTTTGTAGCATTTAATTCTAGTGTGGACTGTTTTTGGCAAAGGAATAAGTGTATAGTCTGTGGGAATCCAGTGAGGTTTTCTTTGAGC
AAGAATGTGGTGAAGGCTGATGCAAGAAAACATTTTTTCCCTAAGGCAGTTAAGGGTACAGGGAAGGGACAAGGGAAGGAGTTTTGGGTT
CTTGGAGGATCTTTX
Edits in Original Sequence 
(5')XCGAGGCAACGCTCCACTATTCCAGGAATTTCAAGACCAACAGCTGXTCTTTCTCTCAATCAACCTAGTGCAAAAACCACCAATGC
CTCAGCAGCGGCAGCCGCCTCAGAAACTCTCAAAGTTGCATTCGCCGCCGGTGGGACCGGAGGCCACATATCCCCCGCTGTGGCAATTGC
AGATGAGCTTAAAAACCAAAACCCTGACATCCAAATCCTCTTCATAGGCACCCCGACCGGGATGGAAAGCGCCGCCGTCCCCTTCGCCGG
CTACCCATTTGTCGCCATCCCGGCAGCCCCTTTAGCCCGCCCTTTAATCTCTGTTCACAACATCTTCATCCTTCCTTTCCTTCXTGACAA
AATCCCTCGTCAAAAGCTTCCAAACCCTTCAAGAGTTCAGCCCACAAATAGTAATcGGCACTGGTGGCTATGTTTCTTTCCCCATTTGCC
TAGCTGCAGCAATGAAAGGTTTAAAATTGGTAATACAAGAGCAAAATTCAGTTCCTGGAATTGCAAATTGGGTGCTTTCTTTATTTGCTG
AGAAAGTTTTTGTAGCATTTAATTCTAGTGTGGACTGTTTTTGGCAAAGGAATAAGTGTATAGTCTGTGGGAATCCAGTGAGGTTTTCTT
TGAGCAAGAATGTGGTGAAGGCTGATGCAAGAAAACATTTTTTCCCTAAGGCAGTTAAGGGTACAGGGAAGGGACAAGGGAAGGtAGTTT
TGGGTTCTTGGAGGATCTTTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan