ESTScan Details for Unigene SGN-U613441

Score 
1345
Direction 
Forward
Predicted Peptide Sequence 
APQAALLITCGDDKTIKVWDAASGSKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLGSRVDYDAPGRWCTTMAYSADG
TRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSLGVVQFDTTRNRFLAAGDDFSVKFWDMDNVQLLTTIDADGGLPASPRIRFNKE
GILLAVSTNENGIKILANNDGLRLLRTFENLAYDASQAEAATKPSLNPIXQQPATNSSGLADREPLLSVFPAVNGESRNLGDVKPRLNEE
TNDKSKIWKLTEISEPSQSRSLKLPENLRVTKISRLMYTNSGSAILALASNAIHLLWKWQRNDRNSSGKATASTSPQLWQPASGILMTND
VIDSSPEEAIHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGH
SKRITGLAFSHVLNVLVSSGADAQLCVWNSDGWEKQKARFLQIPSGRTPMAQSDARVQFHQDQIHFLVVHETQLAIYETTKLECVKQWLP
RESGAPISHATFSCDSQLVYASFLDAAXVRVHSNSLTNEMSLSPPAYLPNSISNSNVQPLVIAAHPQDPNQFAIGLSDGAVHVFEPLESD
GRWGVPPLVDNGSASSLPASAAGGSSSDQGRDDWIDGEMPILPGFVSWQAPSVAQEVEKFESP*
Predicted Coding Sequence 
GCCCCACAAGCAGCTCTGCTGATAACATGTGGTGATGACAAGACAATTAAGGTTTGGGATGCGGCAAGTGGTTCAAAACAATATACCTTT
GAAGGTCATGAGGCTCCAGTTTATTCTGTGTGCCCCCACTACAAAGAAAATATTCAGTTTATCTTTTCAACAGCCCTAGATGGGAAAATT
AAAGCATGGTTATATGATAATTTGGGATCACGAGTTGACTATGATGCGCCTGGCCGTTGGTGTACAACAATGGCCTATAGTGCTGATGGA
ACGAGGCTTTTTTCTTGTGGGACCAGCAAAGATGGGGAATCCCACATTGTTGAATGGAATGAAAGTGAAGGTGCTGTGAAGAGGACATAC
CAAGGCTTTCGAAAACGTTCGCTGGGTGTTGTGCAGTTTGATACAACTAGGAACCGGTTTTTGGCAGCTGGTGATGATTTCTCCGTCAAG
TTTTGGGATATGGACAATGTTCAACTTCTGACAACTATTGATGCTGATGGAGGTCTCCCAGCAAGCCCTCGAATCAGGTTCAATAAAGAG
GGCATCCTGTTGGCTGTTTCTACCAATGAAAATGGGATCAAAATTCTAGCAAATAATGATGGTCTTCGATTGCTGCGAACATTTGAAAAT
CTTGCTTATGATGCATCACAAGCTGAGGCTGCAACCAAGCCCTCGTTGAATCCAATTAXGCAGCAGCCAGCTACTAATAGTTCAGGACTT
GCAGACAGGGAGCCTCTGTTGTCAGTATTTCCTGCAGTGAATGGAGAATCAAGAAACCTGGGAGATGTCAAACCTCGACTCAATGAAGAA
ACAAATGACAAATCCAAAATTTGGAAGCTCACCGAAATTAGTGAACCTTCTCAGAGCCGGTCATTGAAGCTTCCAGAGAATCTGAGGGTG
ACAAAGATATCAAGATTGATGTATACAAATTCAGGTAGTGCCATTTTAGCATTAGCATCAAATGCCATTCATCTGCTCTGGAAATGGCAG
AGAAATGACCGTAATTCAAGTGGCAAGGCAACTGCCAGTACGTCCCCTCAATTATGGCAACCAGCAAGTGGCATATTAATGACAAATGAT
GTAATTGATTCGAGTCCTGAGGAGGCTATACACTGCTTTGCACTGTCTAAGAATGATTCTTATGTGATGTCAGCGTCAGGAGGAAAAATA
TCCCTGTTCAATATGATGACATTTAAGACAATGACAACTTTCATGCCTCCACCTCCTGCAGCTACTTTCTTAGCATTTCATCCTCAAGAT
AACAACATTATTGCTATTGGCATGGATGACTCAACTATTCAGATATACAACGTTCGTGTAGATGAGGTGAAAAGCAAGCTAAAAGGCCAT
TCTAAAAGAATTACTGGCCTTGCTTTCTCCCATGTACTAAATGTGTTAGTCTCATCAGGAGCAGATGCGCAGCTATGTGTGTGGAACTCG
GATGGATGGGAAAAGCAAAAGGCTAGATTTTTGCAAATTCCTTCAGGCAGGACACCTATGGCACAATCGGACGCTCGTGTGCAGTTCCAT
CAGGATCAGATTCACTTCCTGGTTGTCCACGAGACTCAGCTTGCCATATATGAGACAACAAAACTGGAATGTGTCAAGCAGTGGCTTCCG
CGTGAATCTGGTGCTCCAATTTCTCATGCAACATTCTCTTGCGATAGCCAGCTGGTGTATGCCAGCTTCTTAGATGCTGCAGXTGTGCGT
GTTCACAGCAACTCACTTACAAATGAGATGTCGTTAAGTCCTCCTGCTTATCTTCCCAACAGTATAAGCAACTCCAATGTCCAGCCACTT
GTAATTGCTGCACATCCACAGGATCCAAACCAGTTTGCTATAGGTTTATCAGATGGTGCGGTCCATGTTTTTGAGCCCCTTGAATCTGAT
GGCAGATGGGGTGTCCCTCCACTGGTCGATAATGGATCTGCAAGCAGTTTACCAGCGAGTGCAGCTGGAGGCTCAAGCTCTGATCAGGGC
AGAGATGACTGGATAGACGGGGAAATGCCAATTTTACCTGGTTTTGTTTCTTGGCAAGCTCCATCTGTTGCACAAGAAGTAGAAAAATTT
GAATCCCCTTAA
Edits in Original Sequence 
(5')GCCCCACAAGCAGCTCTGCgTGATAACATGTGGTGATGACAAGACAATTAAGGTTTGGGATGCGGCAAGTGGTTCAAAACAATATA
CCTTTGAAGGTCATGAGGCTCCAGTTTATTCTGTGTGCCCCCACTACAAAGAAAATATTCAGTTTATCTTTTCAACAGCCCTAGATGGGA
AAATTAAAGCATGGTTATATGATAATTTGGGATCACGAGTTGACTATGATGCGCCTGGCCGTTGGTGTACAACAATGGCCTATAGTGCTG
ATGGAACGAGGCTTTTTTCTTGTGGGACCAGCAAAGATGGGGAATCCCACATTGTTGAATGGAATGAAAGTGAAGGTGCTGTGAAGAGGA
CATACCAAGGCTTTCGAAAACGTTCGCTGGGTGTTGTGCAGTTTGATACAACTAGGAACCGGTTTTTGGCAGCTGGTGATGATTTCTCCG
TCAAGTTTTGGGATATGGACAATGTTCAACTTCTGACAACTATTGATGCTGATGGAGGTCTCCCAGCAAGCCCTCGAATCAGGTTCAATA
AAGAGGGCATCCTGTTGGCTGTTTCTACCAATGAAAATGGGATCAAAATTCTAGCAAATAATGATGGTCTTCGATTGCTGCGAACATTTG
AAAATCTTGCTTATGATGCATCACAAGCTGAGGCTGCAACCAAGCCCTCGTTGAATCCAATTAXGCAGCAGCCAGCTACTAATAGTTCAG
GACTTGCAGACAGGGtAGCCTCTGTTGTCAGTATTTCCTGCAGTGAATGGAGAATCAAGAAACCTGGGAGATGTCAAACCTCGACTCAAT
GAAGAAACAAATGACAAATCCAAAATTTGGAAGCTCACCGAAATTAGTGAACCTTCTCAGAGCCGGTCATTGAAGCTTCCAGAGAATCTG
AGGGTGACAAAGATATCAAGATTGATGTATACAAATTCAGGTAGTGCCATTTTAGCATTAGCATCAAATGCCATTCATCTGCTCTGGAAA
TGGCAGAGAAATGACCGTAATTCAAGTGGCAAGGCAACTGCCAGTACGTCCCCTCAATTATGGCAACCAGCAAGTGGCATATTAATGACA
AATGATGTAATTGATTCGAGTCCTGAGGAGGCTATACACTGCTTTGCACTGTCTAAGAATGATTCTTATGTGATGTCAGCGTCAGGAGGA
AAAATATCCCTGTTCAATATGATGACATTTAAGACAATGACAACTTTCATGCCTCCACCTCCTGCAGCTACTTTCTTAGCATTTCATCCT
CAAGATAACAACATTATTGCTATTGGCATGGATGACTCAACTATTCAGATATACAACGTTCGTGTAGATGAGGTGAAAAGCAAGCTAAAA
GGCCATTCTAAAAGAATTACTGGCCTTGCTTTCTCCCATGTACTAAATGTGTTAGTCTCATCAGGAGCAGATGCGCAGCTATGTGTGTGG
AACTCGGATGGATGGGAAAAGCAAAAGGCTAGATTTTTGCAAATTCCTTCAGGCAGGACACCTATGGCACAATCGGACGCTCGTGTGCAG
TTCCATCAGGATCAGATTCACTTCCTGGTTGTCCACGAGACTCAGCTTGCCATATATGAGACAACAAAACTGGAATGTGTCAAGCAGTGG
CTTCCGCGTGAATCTGGTGCTCCAATTTCTCATGCAACATTCTCTTGCGATAGCCAGCTGGTGTATGCCAGCTTCTTAGATGCTGCAGXT
GTGCGTGTTCACAGCAACTCACTTACAAATGAGATGTCGTaTAAGTCCTCCTGCTTATCTTCCCAACAGTATAAGCAACTCCAATGTCCA
GCCACTTGTAATTGCTGCACATCCACAGGATCCAAACCAGTTTGCTATAGGTTTATCAGATGGTGCGGTCCATGTTTTTGAGCCCCTTGA
ATCTGATGGCAGATGGGGTGTCCCTCCACTGGTCGATAATGGATCTGCAAGCAGTTTACCAGCGAGTGCAGCTGGAGGCTCAAGCTCTGA
TCAGGcGCAGAGATGACTGGATAGACGGGGAAATGCCAATTTTACCTGGTTTTGTTTCTTGGCAAGCTCCAtTCTGTTGCACAAGAAGTA
GAAAAATTTGAATCCCCTTAA(3')ATGGTTGATTTCAACTATTACTCAAGACCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan