ESTScan Details for Unigene SGN-U614003

Score 
105
Direction 
Forward
Predicted Peptide Sequence 
XAGAKVQAPREHKLTTLLLIKSPQFSNQQKQESMNAEVISSGHLQLYPTSSNQDIVAPSFHLAAGPVPEHSIKAKKKTWAAQKTARAAVY
APTQTQAETFYDMLGISETGSISDIKKAYKQLARKYHPDVSPADRTEEYTKRFIEVQEAYETLSDPQTRALYDMNLGRGLHFAFSTGRRN
ERMDDVEEWKLRWQSQLDELRLWSMHRDNVSSAVSGKAAASPSSSWGSRMRRKRTDIYDLGFXVAYILPIASYKLGPFIVGILSDIIMTD
FAAAAGSTGSCIQ
Predicted Coding Sequence 
XXTGCAGGTGCAAAAGTGCAAGCTCCAAGAGAACACAAATTAACTACACTACTACTGATTAAAAGCCCGCAATTCAGCAACCAACAAAAG
CAAGAAAGCATGAACGCCGAGGTTATTTCCAGCGGTCACCTGCAACTTTACCCAACAAGTTCAAATCAAGACATTGTGGCTCCCAGCTTC
CATTTAGCGGCAGGGCCAGTACCGGAGCATAGCATTAAAGCCAAGAAGAAGACCTGGGCCGCTCAGAAAACTGCCAGGGCCGCCGTTTAT
GCACCGACCCAGACCCAGGCCGAAACTTTCTATGATATGCTGGGAATTTCGGAAACAGGGTCGATTTCCGATATCAAGAAAGCCTACAAA
CAGTTAGCAAGAAAATACCACCCTGACGTGTCACCGGCGGACCGCACGGAAGAGTACACCAAGAGGTTTATCGAGGTTCAGGAAGCTTAC
GAGACGCTTTCTGATCCACAGACTAGAGCTTTGTACGATATGAATTTAGGTCGAGGATTGCATTTCGCTTTTTCAACCGGAAGACGCAAC
GAGAGAATGGATGATGTGGAGGAATGGAAACTTAGGTGGCAATCTCAACTGGATGAGCTGAGGCTGTGGAGCATGCACAGGGATAATGTC
TCCTCCGCCGTTAGTGGGAAGGCAGCGGCGTCGCCCTCGTCGTCCTGGGGTAGTCGAATGCGCCGAAAGAGAACTGACATTTATGATCTT
GGATTTAXGGTAGCATATATTTTGCCTATTGCTAGCTATAAGCTAGGTCCGTTCATCGTGGGGATTCTCTCTGACATAATCATGACAGAT
TTCGCCGCCGCCGCCGGCAGCACTGGGAGCTGTATCCAG
Edits in Original Sequence 
(5')XXTGCAGGTGCAAAAGTGCAAGCTCCAAGAGAACACAAATTAACTACACTACTACTGATTAAAAGCCCGCAATTCAGCAACCAACA
AAAGCAAGAAAGCATGAACGCCGAGGTTATTTCCAGCGGTCACCTGCAACTTTACCCAACAAGTTCAAATaCAAGACATTGTGGCTCCCA
GCTTCCATTTAGCGGCAGGGCCAGTACCGGtAGCATAGCATTAAAGCCAAGAAGAAGACCTGGGCCGCTCAGAAtAACTGCCAGGGCCGC
CGTTTATGCACCGACCCAGACCCAGGCCGAAACTTTCTATGATATGCTGGGAATTTCGGAAACAGGGTCGATTTCCGATATCAAGAAAGC
CTACAAACAGTTAGCAAGAAAATACCACCCTGACGTGTCACCGGCGGACCGCACGGAAGAGTACACCAAGAGGTTTATCGAGGTTCAGGA
AGCTTACGAGACGCTTTCTGATCCACAGACTAGAGCTTTGTACGATATGAATTTAGGTCGAGGATTGCATTTCGCTTTTTCAACCGGAAG
ACGCAACGAGAGAATGGATGATGTGGAGGAATGGAAACTTAGGTGGCAATCTCAACTGGATGAGCTGAGGCTGTGGAGCATGCACAGGGA
TAATGTCTCCTCCGCCGTTAGTGGGAAGGCAGCGGCGTCGCCCTCGTCGTCCTGGGGTAGTCGAATGCGCCGAAAGAGAACTGACATTTA
TGATCTTGGATTTAXGGTAGCATATATTTTGCCTATTGCTAGCTATAAGCTAGGTCCGTTCATCGTGGGGATTCTCTCTGACATAATCAT
GACAGATTTCGCCGCCGCCGCCGGCAGCACTGGGAGCTGTATCCAG(3')ATGTATATAATTAATTTTTTCTCTCTTCTATTTGGACGTG
TTTATAACTCGGCCATATCGTTTTGGCTTCTAGAATTATTGGGAAAAATAAATATTTCCCTTTTTTTTGTGGATAAGATTCTAACTTCTA
TTAATGCACTACTGCCTTTTAATTAATGAAATGGGTTCTTTGATCCAATTGAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan