ESTScan Details for Unigene SGN-U614217

Score 
439
Direction 
Forward
Predicted Peptide Sequence 
MALNLTFYSSFAFFSVWKPKSSDLVIVNNVPLFFNIRDGPYMPTLRLLHQYPNIMKKFQVDRGAIKFVLSGANIMCPGLTPPGGALDDDV
ETKSPVAIMAEGKQHALAIGFTKMSAKDIRSINKGIGVDNMHYLNDGXLEDGAFGLPDTTVKGC
Predicted Coding Sequence 
ATGGCCTTGAATCTAACTTTCTACTCTTCTTTTGCTTTCTTTTCTGTTTGGAAGCCCAAATCATCTGATCTTGTTATAGTGAACAATGTG
CCACTTTTCTTCAATATACGTGATGGACCGTACATGCCTACTCTTCGACTTCTTCATCAATATCCAAATATCATGAAAAAATTCCAAGTT
GATAGGGGCGCGATTAAATTTGTCCTATCTGGGGCAAATATTATGTGTCCTGGGCTTACGCCTCCTGGAGGTGCTTTGGATGATGACGTG
GAAACAAAATCCCCTGTGGCTATAATGGCTGAAGGAAAGCAACATGCTCTCGCTATTGGTTTTACTAAAATGTCAGCTAAAGATATAAGG
TCAATCAATAAAGGAATTGGTGTGGATAATATGCATTATCTTAACGATGGAXCTCTGGAAGATGGAGCGTTTGGATTGCCTGACACAACG
GTCAAAGGATGT
Edits in Original Sequence 
AATTCGGCACGACGCTTGTGTCTTTCTCGGAAAATCGAGCAAAAAATGTTCAAGAAGTTCACATCCAAAGAAGTTTCTGGCCAAAACCAA
GTAAAGGCATCTGTGCAACGCAAAATCCGCCAAAGTGTTGCGGAAGAGGTCTTAATTAGGGCTATACCTATCACATTACTCTGTACTTTC
ACTTTAGTTCTAGCACTTATCAATCTTGTAATCCTTTTTGTTGCAGTATCCAGGACTTGAACCAGTATTGGACGATTTGCTTCCTAAAAA
ATCCCCCCTAATAGTTGCAAAATGGTTTTCTTTTCTTCAACGATCTTTAAATCCTTGTATTTTACTTCTGCCTTTTATCAATTAAATT
(5')
ATGGCCTTGAATCTAACTTTCTACTCTTCTTTTGCTTTCTTTTCTGTTTGGAAGCCCAAATCATCTGaATCTTGTTATAGTGAACAAT
GTGCCACTTTTCTTCAATATACGTGATGGACCGTACATGCCTACTCTTCGACTTCTTCATCAATATCCAAATATCATGAAAAAATTCCAA
GTTGATAGGGGCGCGATTAAATTTGTCCTATCTGGGGCAAATATTATGTGTCCTGGGCTTACGCCTCCTGGAGGTGCTTTGGATGATGAC
GTGGAAACAAAATCCCCTGTGGCTATAATGGCTGAAGGAAAGCAACATGCTCTCGCTATTGGTTTTACTAAAATGTCAGCTAAAGATATA
AGGTCAATCAATAAAGGAATTGGTGTGGATAATATGCATTATCTTAACGATGGAXCTCTGGAAGATGGAGCGTTTGGATTGaCCTGACAC
AACGGTCAAAGGATGT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan