ESTScan Details for Unigene SGN-U614312

Score 
388
Direction 
Forward
Predicted Peptide Sequence 
MSRRPETFFYSRKYPCLFKDLFCVVIIFHYVMASTITDTAAYEVVKLGNTRXERPVLRRPAPQNRAISALPQENSVLIRKLVPGVDRVSF
ALTTVLKPETSDAKASKTVGVASSGSDSHLQEVCAPPVKKVIDINQPQTCKNKGCGKTFKEKDNHDTACSYHPGPAVFHDRMRGWKCCDV
HVKEFDEFMTIPPCTQEWHNADAM*
Predicted Coding Sequence 
ATGAGTCGTAGGCCAGAGACTTTCTTTTACAGTAGGAAGTATCCATGCTTATTCAAGGACCTTTTCTGTGTGGTCATTATTTTCCATTAT
GTCATGGCTTCAACTATCACTGATACTGCTGCTTATGAAGTTGTAAAACTGGGAAACACACGAXCAGAAAGACCAGTGCTGAGAAGGCCA
GCTCCTCAAAATAGAGCAATTTCTGCACTGCCTCAAGAGAACAGTGTGTTGATAAGGAAACTTGTCCCAGGTGTCGACAGGGTTTCTTTT
GCTCTGACCACGGTTCTCAAGCCAGAGACGTCXGATGCAAAAGCATCAAAAACTGTAGGTGTTGCATCTTCTGGGAGTGATTCACATTTG
CAGGAAGTTTGTGCCCCTCCAGTTAAGAAGGTGATTGATATTAACCAGCCTCAGACTTGTAAGAATAAGGGATGTGGGAAAACCTTCAAA
GAAAAGGATAATCATGATACAGCGTGCAGTTATCATCCTGGCCCTGCTGTCTTCCATGACCGGATGAGAGGGTGGAAATGCTGTGATGTT
CATGTCAAGGAATTTGACGAGTTCATGACAATACCACCCTGCACTCAGGAATGGCACAATGCCGATGCCATGTGA
Edits in Original Sequence 
GGTTTTTTTTAGTTGTACGAAGTATTCATGCTTGTTTGACAAGAACTTCTTCTGTACTCTAGTCATTGTTTTCCATTCTGTTAGCAGTGA
AACTAATGCTGGTTTTGCAATCATAAAGCAGTAGGTCTGGAAGTGAAATGGTACTTAAGCAATAGCTTTTTGTTTTCTTTACTTGTCATT
CCAGTATTGCTTCCTTTGATATGAATTCTGTTGCTTAAATGATTTACACATAGGGATATCAGAATATAGTGACCAAGAAAAATAAAA
(5')
ATGAGTCGTAGGCCAGAGACTTTCTTTTAgCAGTAGGAAGTATCCATGCTTATTCAAGGACCTTTTCTGTGTGGTCATTATTTTCCATT
ATGTCATGGCTTCAACTATCACTGATACTGCTGCtTTATGAAGTTGTAAAACTGGGAAACACACGAXCAGAAAGACCAGTGCTGAGAAGG
CCAGCTCCTCAAAATAGAGCAATTTCTGCACTGCCTCAAGAGAACAGTGTGTTGAcTAAGGAAACTTGTCCCAGGTGTCGACAGGGTTTC
TTTTGCTCTGACCACGGTTCTCAAGCCAGAGACGTCXGATGCAAAAGCATCAAAAACTGTAGGTGTTGCATCTTCTGGGAGTGATTCACA
TTTGCAGGAAGTTTGTGCCCCTCCAGTTAAGAAGGTGATTGATATTAACCAGCCTCAGACTTGTAAGAATAAGGGATGTGGGAAAACCTT
CAAAGAAAAGGATAATCATGATACAGCGTGCAGTTATCATCCTGGCCCTGCTGTCTTCCATGACCGGATGAGAGGGTGGAAATGCTGTGA
TGTTCATGTCAAGGAATTTGACGAGTTCATGACAATACCACCCTGCACTCAGGAATGGCACAATGCCGATGCCATGTGA(3')AGAATGG
ATAAGGTTTTTTCCCCCCTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan