ESTScan Details for Unigene SGN-U614820

Score 
1090
Direction 
Forward
Predicted Peptide Sequence 
XALRSLPIPTRQLNPSSSEAAEMAEPKLFELNNGTIQLKVSSLGCTITSLSVPDKNGKLGDVVLGFDALEPYLKGAAPYFGCIVGRVANR
IKDGKFTLDGAHYSLPINKPPNSLHGGHKGYDKVVWELVEHKQGNEPSITFKYYSRDGEEGYPGELAVTATYTLTSATTLRLDMKAVPQN
KPTPVSLAQHTYWNLGGHNSGNVLDHTIQIWAKHVTPVDQNTIPTGEIMPVKDTPFDFTTEQKIGSRIHEVGIGYDHNYVLDCEDEQWGL
KHAVKLKDPVSSRVLNLWTNAPGMQFYTANYYMEFVGKGGAQYDKHSGVLLEKQGIPNAIINQIS
Predicted Coding Sequence 
XGCGCACTTAGAAGCCTTCCAATCCCAACTCGACAACTCAATCCATCTTCATCAGAAGCTGCTGAAATGGCAGAACCAAAGCTCTTTGAA
CTCAACAATGGCACCATCCAACTCAAGGTCTCCAGTCTTGGCTGTACCATCACCTCATTGTCTGTCCCCGATAAAAATGGAAAATTGGGC
GATGTTGTTCTTGGATTTGACGCACTTGAGCCGTATCTGAAAGGGGCTGCACCTTATTTTGGCTGCATTGTTGGCCGGGTTGCAAACAGG
ATTAAAGATGGCAAATTTACACTCGATGGTGCTCACTACTCCTTGCCCATCAACAAGCCTCCAAACAGTCTCCATGGTGGGCATAAGGGA
TATGACAAGGTTGTGTGGGAATTAGTGGAACACAAGCAAGGCAATGAACCATCAATCACATTCAAATACTATAGCCGTGATGGGGAGGAA
GGTTATCCAGGGGAATTAGCTGTAACTGCAACTTATACACTCACCTCGGCAACAACATTGAGGCTAGACATGAAAGCTGTGCCTCAAAAC
AAACCAACCCCAGTGAGTTTAGCTCAACATACCTATTGGAACTTAGGAGGCCACAACTCAGGAAACGTTCTTGATCATACTATTCAGATA
TGGGCAAAGCATGTTACTCCTGTGGATCAGAATACAATCCCAACAGGAGAAATCATGCCAGTTAAAGATACTCCTTTTGACTTCACCACT
GAGCAGAAAATTGGTAGTCGTATCCATGAGGTTGGCATAGGCTATGACCACAACTATGTGCTTGATTGTGAAGATGAGCAATGGGGGCTG
AAGCATGCGGTGAAATTGAAGGATCCAGTGAGTTCAAGAGTTCTGAACTTATGGACAAATGCTCCTGGTATGCAGTTTTATACAGCCAAC
TACTACATGGAATTTGTTGGTAAAGGAGGTGCTCAGTATGACAAACATTCTGGGGTTTTGTTGGAAAAACAGGGAATTCCCAATGCGATC
ATCAACCAAATTTCX
Edits in Original Sequence 
(5')XGCGCACTTAGAAGCCTTCCAATCCCAACTCGACAACTCAATCCATCTTCATCAGAAGCTGCTGAAATGGCAGAACCAAAGCTCTT
TGAACTCAACAATGGCACCATCCAACTCAAGGTCTCCAGTCTTGGCTGTACCATCACCTCATTGTCTGTCCCCGATAAAAATGGAAAATT
GGGCGATGTTGTTCTTGGATTTGACGCACTTGAGCCGTATCTGAAAGGGGCTGCACCTTATTTTGGCTGCATTGTTGGCCGGGTTGCAAA
CAGGATTAAAGATGGCAAATTTACACTCGATGGTGCTCACTACTCCTTGCCCATCAACAAGCCTCCAAACAGTCTCCATGGTGGGCATAA
GGGATATGACAAGGTTGTGTGGGAATTAGTGGAACACAAGCAAGGCAATGAACCATCAATCACATTCAAATACTATAGCCGTGATGGGGA
GGAAGGTTATCCAGGGGAATTAGCTGTAACTGCAACTTATACACTCACCTCGGCAACAACATTGAGGCTAGACATGAAAGCTGTGCCTCA
AAACAAACCAACCCCAGTGAGTTTAGCTCAACATACCTATTGGAACTTAGGAGGCCACAACTCAGGAAACGTTCTTGATCATACTATTCA
GATATGGGCAAAGCATGTTACTCCTGTGGATCAGAATACAATCCCAACAGGAGAAATCATGCCAGTTAAAGATACTCCTTTTGACTTCAC
CACTGAGCAGAAAATTGGTAGTCGTATCCATGAGGTTGGCATAGGCTATGACCACAACTATGTGCTTGATTGTGAAGATGAGCAATGGGG
GCTGAAGCATGCGGTGAAATTGAAGGATCCAGTGAGTTCAAGAGTTCTGAACTTATGGACAAATGCTCCTGGTATGCAGTTTTATACAGC
CAACTACgTACATGGAATTTGTTGGTAAAGGAGGTGCTCAGTATGACAAACATTCTGGGGTTTTGTTGGAAAAACAGGGAATTCCCAATG
CGATCATCAACCAAATTTCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan