ESTScan Details for Unigene SGN-U615590

Score 
510
Direction 
Forward
Predicted Peptide Sequence 
MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIF
VVDSNDRDRVVEARDELHRMLNXGLSTLSVGFGNMITASGGYVLKTLLGVSIFVPANVLSCLLFLCFASKELSFSFSSDLQLGLLQKRFR
LEKVAXEMWKSGQVEMKHSSSRTALLVFPKAMGEFFFYIALPDLILYDFTYADS*
Predicted Coding Sequence 
ATGGGGCTTACCTTCACTAAGCTGTTCAGCAGGCTGTTTGCCAAGAAAGAGATGAGGATTCTGATGGTAGGTCTTGATGCTGCTGGTAAG
ACTACAATACTGTACAAGCTCAAGCTTGGAGAAATTGTCACTACTATTCCTACCATTGGCTTTAATGTTGAAACTGTGGAGTATAAGAAT
ATTAGCTTCACCGTGTGGGATGTTGGTGGCCAGGACAAGATCCGTCCATTATGGAGGCACTACTTCCAAAACACACAGGGTCTTATATTT
GTGGTGGATAGCAATGACAGGGACCGAGTTGTTGAAGCTAGGGATGAGCTGCATAGGATGTTAAATGXAGGTTTGTCAACCCTTTCTGTT
GGATTTGGAAATATGATCACAGCATCTGGTGGATATGTTTTAAAAACTCTGTTGGGAGTTTCCATCTTTGTTCCAGCAAATGTTTTGTCT
TGTTTGTTATTTTTATGTTTTGCGTCTAAGGAATTATCTTTTTCCTTTTCCAGCGATCTCCAATTGGGGTTGCTTCAAAAGAGGTTTAGA
TTAGAAAAAGTAGCTGAXGAGATGTGGAAATCTGGCCAGGTTGAGATGAAACATTCATCAAGCAGGACXGCACTGTTGGTTTTCCCGAAA
GCTATGGGAGAATTTTTCTTTTATATTGCGCTACCTGATTTAATCTTATATGATTTCACATATGCTGATTCATGA
Edits in Original Sequence 
GGACAGATCGACCTCCTTCGAAACTAGCGGCCCTCTATCTCTCTCTGCTTCAAGGAAATCTTTTTCCCACTCGATTCCTTCTGCCAGACT
TTATCCAAGAGGTTTCCACATTCGGCAGTGTTGAGTGATCCGAGCAGAG
(5')ATGGGGCTTACCTTCACTAAGCTGTTCAGCAGGCTGT
TTGCCAAGAAAGAGATGAGGATTCTGATGGTAGGTCTTGATGCTGCTGGTAAGACTACAATACTGTACAAGCTCAAGCTTGGAGAAATTG
TCACTACTATTCCTACCATTGGCTTTAATGTTGAAACTGTGGAGTATAAGAATATTAGCTTCACCGTGTGGGATGTTGGTGGCCAGGACA
AGATCCGTCCATTATGGAGGCACTACTTCCAAAACACACAGGGTCTTATATTTGTGGTGGATAGCAATGACAGGGACCGAGTTGTTGAAG
CTAGGGATGAGCTGCATAGGATGTTAAATGXAGGTTTGTCAACCCTTTCTGTTGGATTTGGAAATATGATCACAGCATCTGaGTGGATAT
GTTTTAAAAACTCTGTTGGGAGTTTCCATCTTTGTTCCAGCAAATGTTTTGTCTTGTTTGTTATTTTTATGTTTTGCGTCTAAGGAATTa
ATCTTTTTCCTTTTCCAGCGATCTCCAATTGGGGTTGCTTCAAAAGAGGTTTAGATTAGAAAAAGTAGCTGAXGAGATGTGGAAATCTGG
CCAGGTTGAGATGAAACATTCATCAAGCAGGACXGCACTGTTGGTTTTCCCGAAAGCTATGGGAGAATTTTTCTTTTATATTGCGCTACC
TGATTTAATCTTATATGATTTCACATATGCTGATTCATGA(3')ACCAACTTAGTATTTCATCATTTGTTCCCTTTTGTCTTGCAATTTT
TTCTGAACTTGTTTACTGCCGGAGTTCTGTCTGGGCAACCTTTTTTTTTTTGGACTTTCCAGATCTTTTACCTGTACATCTGAGGCTTAG
ATCAATGGTTGATACCCCACCCCTTTTCCCTCAAATGCATGTGCAAGTCCATCTCATGTGGCTCAAAATTTGACCTAACTAACCCGATTT
AGTTAATAAATGACTTCTGCTTTCAATTCATTGATCTGGATATGGTATTAGGAGTCCGTAGGGTTCCCACGGTACTGCTGTTACTAATGA
GACTTACCCATATTTATATCGACTAATTACTTTTGCGAATAAAATCAATGAAGTGATATGACTTGGCAGGACAAGAGGGTTTGACTGACT
TTTGTGTCTGGTTTCAGGATGAACTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan