ESTScan Details for Unigene SGN-U615841

Score 
1466
Direction 
Forward
Predicted Peptide Sequence 
XXSESLLLYGSFKNIIVVTTTNFLLSSLAAPTQAQQAYQFGHRDYFSLRLKILKCAPPPSAASCRLLRLFGASGSPTSNCNPSWLESSEQ
TQPPPTRATAKPTELHISAHAHGPSGTIVCGTGACFVFVAAEVAPWSKTGGLGDVLGGLPPALAGLGHRVMTVAPRYDQYKDGWDTSVLV
QIKVGDRIEVVRFFHCYKRGVDRVFVDHPIFLEKVWGKTGSKIYGPRAGDDXPGQPAAVQLVVPSSFGGTTILSLNNNKYFSGTYGEDVI
FIANDWHCALLPCYLKTMYQSRGIYMNAKVAFCIHNIAYQGRFPFADFSLLNLPDQYKSSFDFIDGYDKPVKGRKINWMKAGILESNRVL
TVSPYYALELVSGIEKGXGIGQYSPHEMVTGIVNGMDTHEWNPATDKYISANYDITTVMHAKALLKEALQAAVGLPVDRNIPLIGFIGRL
EEQKGSDILVAAIPKLIHMNVQIVILGTGKRKFEKQIEQLEVMYPDKARGVAKFNVPLAHMIIAGADFMLLPSRFEPCGLIQLHAMRYGT
VPICASTGGLVDTVKDGYTGFHMGAFSVECDAVDPADILKIVVTVARALASYGTLALKEMIRNCMSQELSWKGPAKKWETVLVSLGVAGS
EAGVDGDEIAPLAKENVATP*
Predicted Coding Sequence 
XXTAGNAGCGAGTCTCTGCTACTCTACGGGTCCTTTAAAAATATAATAGTTGTTACTACTACTAACTTCCTGCTTTCCTCCCTCGCTGCT
CCTACTCAGGCTCAACAGGCATATCAGTTTGGCCACCGTGACTACTTCTCGCTTCGTCTCAAGATCCTCAAATGTGCACCACCACCCTCC
GCCGCCTCCTGCAGACTCCTCCGCCTATTTGGCGCATCTGGGTCTCCGACCTCAAACTGTAACCCATCATGGCTTGAGAGCAGTGAGCAG
ACTCAACCTCCACCAACCAGAGCCACTGCCAAACCAACCGAACTCCACATATCCGCTCACGCTCACGGGCCTTCCGGAACCATCGTCTGC
GGAACAGGAGCCTGTTTCGTCTTTGTGGCCGCTGAAGTCGCTCCTTGGAGCAAAACTGGTGGCCTCGGGGATGTTTTGGGAGGATTGCCA
CCAGCTTTGGCTGGCTTGGGTCACCGAGTGATGACTGTTGCACCTCGTTATGATCAGTACAAAGATGGTTGGGATACAAGTGTGCTTGTC
CAGATCAAGGTCGGAGATAGAATTGAGGTTGTTCGTTTTTTCCACTGCTACAAGCGTGGAGTAGATCGTGTTTTTGTGGATCATCCAATC
TTTCTCGAGAAGGTTTGGGGCAAAACTGGATCAAAGATCTATGGTCCTAGGGCTGGAGATGATXTACCAGGACAACCAGCTGCGGTTCAG
CTTGTTGTGCCAAGCAGCTTTGGAGGCACCACAATTTTGAGTTTAAACAACAACAAATACTTCTCTGGAACATATGGAGAGGATGTTATC
TTCATTGCCAATGATTGGCATTGTGCTCTTCTACCATGCTACCTGAAGACTATGTACCAGTCTAGAGGAATCTACATGAACGCTAAAGTT
GCTTTCTGCATTCACAACATTGCCTACCAGGGAAGATTTCCTTTTGCAGACTTCTCTCTTCTCAATCTCCCTGATCAATATAAGAGTTCC
TTTGACTTCATTGATGGATATGACAAACCAGTGAAAGGAAGGAAAATTAACTGGATGAAGGCTGGAATTTTGGAGTCAAACAGGGTCTTA
ACTGTGAGCCCGTACTATGCCCTGGAGCTTGTTTCTGGCATTGAAAAGGGTGXTGGAATTGGACAATATTCTCCGCATGAAATGGTAACA
GGAATTGTGAATGGAATGGATACCCACGAGTGGAATCCGGCGACTGATAAATATATTTCTGCCAATTATGACATTACAACTGTTATGCAT
GCAAAGGCCCTACTAAAAGAAGCTCTCCAAGCTGCTGTTGGATTACCAGTTGACAGGAATATTCCGCTGATTGGCTTCATTGGCAGGCTC
GAAGAGCAGAAAGGATCAGACATCCTTGTTGCCGCCATTCCCAAGCTCATTCACATGAATGTTCAGATAGTAATCCTTGGGACTGGCAAA
AGGAAATTTGAGAAGCAGATTGAACAGCTTGAGGTGATGTACCCCGACAAAGCAAGAGGAGTGGCAAAATTCAATGTCCCATTAGCCCAC
ATGATTATTGCTGGAGCTGACTTTATGCTGCTTCCAAGTAGATTTGAACCTTGTGGTCTAATTCAACTGCACGCCATGCGCTATGGAACA
GTGCCTATATGTGCTTCGACTGGTGGACTTGTTGACACAGTCAAAGATGGCTACACGGGGTTCCATATGGGAGCCTTCAGCGTTGAATGC
GATGCGGTTGATCCAGCTGACATCCTCAAGATCGTAGTGACTGTAGCCAGAGCTCTCGCTAGCTATGGAACCCTTGCCCTAAAAGAGATG
ATTAGAAATTGCATGTCACAGGAGCTCTCCTGGAAGGGGCCTGCTAAGAAGTGGGAAACAGTGTTGGTGAGCTTAGGTGTTGCTGGGAGT
GAAGCTGGCGTTGACGGAGACGAAATTGCCCCACTCGCCAAGGAAAACGTTGCCACACCTTGA
Edits in Original Sequence 
(5')XXTAGNAGCGAGTCTCTGCTACTCTACGGGTCCTTTAAAAATATAATAGTTGTTACTACTACTAACTTCCTGCTTTCCTCCCTCGC
TGCTCCTACTCAGGCTCAACAGGCATATCAGTTaTGGCCACCGTGACTACTTCTCGCTTCGTCTCAAGATCCTCAAATGTGCACCACCAC
CCTCCGCCGCCTCCTGCAGACTCCTCCGCCTATTTGGCGCATCTGGGTCTCCGACCTCAAACTGTAACCCATCATGGCTTGAGAGCAGTG
AGCAGACTCAACCTCCACCAtACCAGAGCCACTGCCAAACCAACCGAACTCCACATATCCGCTCACGCTCACGGGCCTTCCGGAACCATC
GTCTGCGGAACAGGAGCCTGTTTCGTCTTTGTGGCCGCTGAAGTCGCTCCTTGGAGCAAAACTGGTGGCCTCGGGGATGTTTTGGGAGGA
TTGCCACCAGCTTTGGCTGGCTTGGGTCACCGAGTGATGACTGTTGCACCTCGTTATGATCAGTACAAAGATGGTTGGGATACAAGTGTG
CTTGTCCAGATCAAGGTCGGAGATAGAATTGAGGTTGTTCGTTTTTTCCACTGCTACAAGCGTGGAGTAGATCGTGTTTTTGTGGATCAT
CCAATCTTTCTCGAGAAGGTTTGGGGCAAAACTGGATCAAAGATCTATGGTCCTAGGGCTGGAGATGATXTACCAGGACAACCAGCTGCG
GTTCAGCTTGTTGTGCCAAGCAGCTTTGGAGGCACCACgAATTTTGAGTTTAAACAACAACAAATACTTCTCTGGAACATATGGAGAGGA
TGTTATCTTCATTGCCAATGATTGGCATTGTGCTCTTCTACCATGCTACCTGAAGACTATGTACCAGTCTAGAGGAATCTACATGAACGC
TAAAGTTGCTTTCTGCATTCACAACATTGCCTACCAGGGAAGATTTCCTTTTGCAGACTTCTCTCTTCTCAATCTCCCTGATCAATATAA
GAGTTCCTTTGACTTCATTGATGGATATGACAAACCAGTGAAAGGAAGGAAAATTAACTGGATGAAGGCTGGAATTTTGGAGTCAAACAG
GGTCTTAACTGTGAGCCCGTACTATGCCCTGGAGCTTGTTTCTGGCATTGAAAAGGGTGXTGGAATTGGACAATATTCTCCGCATGAAAT
GcGTAACAGGAATTGTGAATGGAATGGATACCCACGAGTGGAATCCGGCGACTGATAAATATATTTCTGCCAATTATGACATTACAACTG
TTATGCATGCAAAGGCCCTACTAAAAGAAGCTCTCCAAGCTGCTGTTGGATTACCAGTTGACAGGAATATTCCGCTGATTGGCTTCATTG
GCAGGCTCGAAGAGCAGAAAGGATCAGACATCCTTGTTGCCGCCATTCCCAAGCTCATTCACATGAATGTTCAGATAGTAATCCTTGGGA
CTGGCAAAAGGAAATTTGAGAAGCAGATTGAACAGCTTGAGGTGATGTACCCCGACAAAGCAAGAGGAGTGGCAAAATTCAATGTCCCAT
TAGCCCACATGATTATTGCTGGAGCTGACTTTATGCTGCTTCCAAGTAGATTTGAACCTTGTGGTCTAATTCAACTGCACGCCATGCGCT
ATGGAACAGTGCCTATATGTGCTTCGACTGGTGGACTTGTTGACACAGTCAAAGATGGCTACACGGGGTTCCATATGGGAGCCTTCAGCG
TTGAATGCGATGCGGTTGATCCAGCTGACATCCTCAAGATCGTAGTGACTGTAGCCAGAGCTCTCGCTAGCTATGGAACCCTTGCCCTAA
AAGAGATGATTAGAAATTGCATGTCACAGGAGCTCTCCTGGAAGGGGCCTGCTAAGAAGTGGGAAACAGTGTTGGTGAGCTTAGGTGTTG
CTGGGAGTGAAGCTGGCGTTGACGGAGACGAAATTGCCCCACTCGCCAAGGAAAACGTTGCCACACCTTGA(3')GTGTCTCATCCATCA
TCCAGCTTAGCTATATATAGTTAGCCTATTGCCTCTCACCTTTTAACCCTTTTTAATAAAAGCGAAGTAACGGATCAGGTGAAGCTTTAT
CTAATAGTACTTGTAAAAATCGCCAGCATTGTTGTTGTTGTTGTTTGGGGGGGGGGGGTATTTTTGTGTTTCATCCAGTTTTCTGGTTAG
GATAAAGGAGATTATTATGCCTGCAGATTATGCTTTTGTTGAGCTGTTGCTGGAAAGGTGGATTTGGAGGAGAAGAAAAAGGGGATGATG
AATGAATGTAGTATAATAGATAGATAAATAAGACCGTAACAAACTGCGGTGTGGCTCAATCGACGACCGTAGAGCTTGTTCTCGAGCACC
ATGTGAAATAAATAAATCAATAGAAAATTCTTACCGTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan