ESTScan Details for Unigene SGN-U616091

Score 
532
Direction 
Forward
Predicted Peptide Sequence 
EGGTEGSLLLYLTSVTQTYSWMKQAENSHSIAIPLLDGANESNELKPEGHLSTLGSTSFWKTCFHGVNSLSGVGILSVPYALSSGGWXEL
IPSLYHCMLNPLHWLLDSKMYGFGNHHKAFPDIGQRAFGAKGRTLVSIIMNAELYLVATGFLIIEGDNLSNLFPDVGFAIGGFNIGARQS
FVIMVGLIILPTVWLNNMNILSYXHQLSGVVASVVLLCSILWTGAFDGIGFHEKX
Predicted Coding Sequence 
GAGGGGGGCACXGAGGGCTCACTTTTGCTTTATCTAACAAGTGTTACACAAACTTATTCATGGATGAAACAAGCAGAAAATAGCCACTCA
ATTGCCATACCTCTCCTGGATGGAGCTAATGAGTCCAATGAATTGAAGCCTGAAGGACATCTTTCCACTTTAGGCTCTACATCATTTTGG
AAAACATGCTTCCATGGAGTCAATTCTTTATCAGGTGTTGGGATACTCTCAGTCCCATATGCACTATCATCAGGTGGATGGXTTGAGCTT
ATTCCTTCTCTTTATCATTGCATGCTCAACCCTCTACACTGGCTTCTTGATTCAAAGATGTATGGATTTGGAAACCACCATAAGGCTTTT
CCTGATATCGGGCAACGGGCATTTGGGGCAAAAGGAAGAACACTTGTATCAATCATAATGAATGCTGAACTTTATTTGGTGGCTACTGGT
TTCTTGATTATTGAAGGAGATAATTTGTCAAACTTATTTCCAGATGTTGGGTTTGCAATAGGTGGTTTTAATATTGGTGCAAGACAAAGT
TTTGTTATCATGGTTGGACTTATAATTCTTCCCACGGTTTGGTTGAATAATATGAATATTCTTTCATATGXTCATCAGCTAAGTGGAGTT
GTGGCTTCAGTTGTACTTCTTTGCTCAATTTTGTGGACTGGTGCATTTGATGGGATTGGATTTCATGAAAAGGXX
Edits in Original Sequence 
(5')GAGGGGGGCACXGAGGGCTCACTTTTGCTTTATCTAACAAGTGTTACACAAACTTATTCATGGATGAAACAAGCAGAAAATAGCCA
CTCAATTGCCATACCTCTCCTGGATGGAGCTAATGAGTCCAATGAATTGAAGCCTGAAGGACATCTTTCCACTTTAGGCTCTACATCATT
TTGGAAAACATGCTTCCATGGAGTCAATTCTTTATCAGGTGTTGGGATACTCTCAGTCCCATATGCACTATCATCAGGTGGATGGXTTGA
GCTTATTCCTTCTCTTTATCATTGCATGCTCAACCCTCTACACTGGCTTCTTGATTCAAAGATGTATGGATTTGGAAACCACCATAAGGa
CTTTTCCTGATATCGGGCAACGGGCATTTGGGGCAAAAGGAAGAACACTTGTATCAATCATAATGAATGCTGAACTTTATTTGGTGGCTA
CTGGTTTCTTGATTATTGAAGGAGATAATTTGTCAAACTTATTTCCAGATGTTGGGTTTGCAATAGGTGGTTTTAATATTGGTGCAAGAC
AAAGTTTTGTTATCATGGTTGGACTTATAATTCTTCCCACGGTTTGGTTGAATAATATGAATATTCTTTCATATGXTCATCAGCTAAGTG
GAGTTGTGGCTTCAGTTGTACTTCTTTGCTCAATTTTGTGGACTGGTGCATTTGATGGGATTGGATTTCATGAAAAGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan