ESTScan Details for Unigene SGN-U616273

Score 
429
Direction 
Forward
Predicted Peptide Sequence 
DPLFPGLPPPPPDHTLLSDGKHPTQPSGLYVSLSVSLGVLATTFLIFSIYMIYKFYKRRYTSSRSRQLIPQPQQQPREDEEAHLDFLDED
QGPVVDHPIWYIRTVGLQPSVINAITICKYKRGDGLVEGTECSVCLNEFQEDETXKAAAQXVIMLFIYLALILGSDHTPIAPIAXAGIVV
STANLQSSSQSHHNSGRVEEIQMGVSENNRDSERERERESEVLEVGVEAEQENESRVGTGNAX
Predicted Coding Sequence 
GATCCACTCTTTCCCGGTCTGCCTCCACCACCTCCTGATCATACTTTGCTTTCTGATGGCAAGCATCCTACCCAGCCATCTGGACTCTAT
GTCTCCCTCTCCGTGTCTCTTGGTGTTTTAGCCACAACTTTCTTGATTTTCTCTATCTACATGATATACAAGTTTTATAAACGTCGGTAT
ACGTCTTCAAGGAGTAGGCAATTGATTCCACAGCCCCAGCAGCAGCCTCGAGAGGATGAAGAAGCCCATCTGGATTTTCTTGATGAAGAT
CAGGGTCCCGTGGTTGACCATCCCATATGGTATATCAGGACAGTTGGTCTTCAGCCGTCTGTGATTAATGCAATCACTATTTGTAAGTAT
AAAAGAGGTGATGGACTGGTGGAAGGAACAGAGTGCTCTGTTTGCTTGAATGAATTTCAAGAAGATGAGACTXTTAAGGCTGCTGCCCAA
GXTGTAATCATGCTTTTCATATACCTTGCATTGATACTTGGCTCAGATCACACACCAATTGCCCCAATTGCCGXAGCTGGGATTGTTGTG
AGCACGGCTAACCTCCAGTCTTCGTCGCAGAGTCATCATAATTCAGGTCGTGTGGAGGAAATCCAAATGGGAGTTTCGGAAAATAATAGG
GATTCCGAGAGAGAAAGGGAAAGGGAAAGTGAGGTTCTTGAAGTCGGTGTTGAAGCGGAACAAGAAAATGAATCAAGGGTAGGAACCGGA
AATGCATXX
Edits in Original Sequence 
(5')GATCCACTCTTTCCCGGTCTGCCTCCACCACCTCCTGATCATACTTTGCTTTCTGATGGCAAGCATCCTACCCAGCCATCTGGACT
CTATGTCTCCCTCTCCGTGTCTCTTGGTGTTTTAGCCACAACTTTCTTGATTTTCTCTATCTACATGATATACAAGTTTTATAAACGTCG
GTATACGTCTTCAAGGAGTAGGCAATTGATTCCACAGCCCCAGCAGCAGCCTCGAGAGGATGAAGAAGCCCATCTGGATTTTCTTGATGA
AGATCAGGGTCCCGTGGTTGACCATCCCATATGGTATATCAGGACAGTTGGTCTTCAGCCGTCTGTGATTAATGCAATCACTATTTGTAA
GTATAAAAGAGGTGATGGACTGGTGGAAGGAACAGAGTGCTCTGTTTGCTTGAATGAATTTCAAGAAGATGAGACTXTTAAGGCTGCTGC
CCAAGXTGTAATCATGCTTTTCATATACCTTGCATTGATACTTGGCTCAGATCACACACCAATTGCCCCAATTGCCGXAGCTGGGATTGT
TGTGAGCACGGCTAACCTCCAGTCTTCGTCGCAGAGTCATCATAATTCAGGTCGTGTGGAGGAAATCCAAATGGGAGTTTCGGAAAATAA
TAGGGATTCCGAGAGAGAAAGGGAAAGGGAAAGTGAGGTTCTTGAAGTCGGTGTTGAAGCGGAACAAGAAAATGAATCAAGGGTAGGAAC
CGGAAATGCATXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan