Notice: SGN will be briefly unavailable for maintenance. Apologies.

ESTScan Details for Unigene SGN-U616473

Score 
399
Direction 
Forward
Predicted Peptide Sequence 
XGKDVLKLVLGKHNLTSAISAYTRTEVVTKQQSYFFSHSLKAIATTSTAKGITSKQLLIGTVGDQVLALDKRFLDPRRTLNPTQAEKEEG
IIPLTDSLPIIPQSYVTHALKVEGLRGIVTVPAEVRVNYSRLCPWGGSLFYQACTFKTYDSLTEDFSYALLLITIVALVVAIFVTWILSE
RKELQEKWR*
Predicted Coding Sequence 
XCAGGCAAGGATGTCTTGAAGTTGGTTCTTGGGAAACATAATTTGACCTCAGCTATTTCAGCTTACACTCGTACAGAAGTCGTGACTAAA
CAGCAATCTTACTTTTTTTCCCACTCTCTGAAAGCAATAGCCACAACATCCACAGCTAAAGGCATAACTTCCAAACAACTACTTATTGGC
ACTGTTGGTGATCAGGTTTTGGCACTTGATAAACGTTTCTTGGATCCTCGGCGAACACTTAACCCCACACAAGCTGAGAAAGAGGAAGGA
ATTATACCGCTTACCGATTCATTACCAATCATTCCACAGTCTTACGTGACGCATGCCCTCAAGGTGGAAGGCCTTAGAGGCATAGTAACT
GTCCCTGCXGAAGTTAGAGTCAACTACTCTCGTCTTTGCCCATGGGGTGGATCTCTTTTTTACCAGGCTTGCACCTTCAAGACCTATGAT
TCTCTTACTGAAGACTTCAGTTACGCTCTCCTGCTCATTACAATTGTTGCACTTGTGGTGGCTATATTCGTGACTTGGATTTTGTCAGAA
AGGAAGGAGCTGCAGGAGAAGTGGAGATGA
Edits in Original Sequence 
(5')XCAGGCAAGGATGTCTTGAAGTTGGTTCTTGGGAAACATAATTTGACCTCAGCTATTTCAGCTTACACTCGTACAGAAGTCGTGAC
TAAACAGCAATCTTACTTTTTTTCCCACTCTCTGAAAGCAATAGCCACAACATCCACAGCTAAAGGCATAACTTCCAAACAACTACTTAT
TGGCACTGTTGGTGATCAGGTTTTGGCACTTGATAAACGTTTCTTGGATCCTCGGCGAACACTTAACCCCACACAAGCTGAGAAAGAGGA
AGGAATTATACCGCTTACCGATTCATTACCAATCATTCCACAGTCTTACGTGACGCATGCCCTCAAGGTGGAAGGCCTTAGAGGCATAGT
AACTGTCCCTGCXGAAGTTAGAGTCAACTACTCTCGTCTTTGCCCATGGGGTGGATCTCTTTTTTACCAGGCTTGCACCTTCgAAGACCT
ATGATTCTCTTACTGAAGACTTCAGTTACGCTCTCCTGCTCATTACAATTGTTGCACTTGTGGTGGCTATATTCGTGACTTGGATTTTGT
CAGAAAGGAAGGAGCTGCAGGAGAAGTGGAGATGA(3')AAGCTCTAATCTTATTTTTTGCAGTTACACTAGTTTTTCCTTTTAGATTCT
TATTGGGTCTTTCTTTTTTGTTCTTTATTTTGAAAGTCCTCTAGCATTGCAAATCATCTGTAATTTAGGTTGATTTTGTACCAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan