ESTScan Details for Unigene SGN-U616474

Score 
630
Direction 
Forward
Predicted Peptide Sequence 
AIVDAYTGKELNSVGPFHSIVQIIPLPHTDSREQRLHLLIDKDWQPTYIPEVLRLLPFFNARLETFIGIQXEADNGILRGHAAKENCILQ
LPDEYCFGTRNLWSIVFPSESERIIATATRKLNEAVHTQAKVVADQDVMYKYISKNLLFIATVAPQAAGDIGSVTPDESWLVVYLVDTIT
GRILHRMTHYGSQGPVHAVVSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDVLKLVLGKHNLTSAISAYTRTEVVTKQQSYFFSHSV
KAISTTSTAKGITSKQLLIGTVGDQVLALDKRFLDPRRTLNPTQAEKEEGIIPLTDSLPIIPQSYVTHALKVEGLRGIVTVPAEVRVNYS
RLCPWGGSLFYQACTFEDYDFSTEDFSYALLLITIV
Predicted Coding Sequence 
GCCATTGTTGATGCATACACAGGAAAGGAGCTTAATTCTGTTGGACCTTTTCATTCGATCGTGCAAATTATTCCTCTGCCACATACTGAT
TCCAGAGAGCAGCGTTTGCATCTATTGATAGATAAGGATTGGCAGCCCACTTATATCCCAGAAGTCCTGAGGCTCTTGCCATTTTTCAAC
GCGAGGTTGGAAACATTTATTGGTATTCAGXTGGAAGCTGATAATGGTATCTTAAGGGGACATGCAGCAAAGGAGAATTGCATTTTACAG
CTGCCTGATGAATATTGTTTCGGCACGAGGAATCTGTGGTCAATTGTTTTCCCTTCAGAATCAGAAAGGATCATTGCAACTGCAACCAGG
AAGTTGAATGAGGCAGTTCACACTCAAGCAAAAGTAGTAGCGGATCAGGATGTGATGTATAAATATATATCTAAGAATCTGCTCTTCATT
GCAACTGTTGCTCCACAAGCAGCTGGAGATATTGGATCTGTCACCCCTGATGAATCTTGGCTGGTTGTTTATCTTGTTGACACCATAACT
GGACGTATTCTGCATCGCATGACCCATTATGGTTCACAGGGTCCTGTCCATGCAGTCGTTAGTGAGAATTGGGTTGTTTACCACTACTTT
AACCTTAGAGCTCACAGATATGAGATGTCTGTGATCGAAATTTATGATCAGTCTCGGGCGGACAACAAGGATGTCTTGAAGTTGGTTCTT
GGGAAACATAATTTGACCTCAGCTATTTCAGCTTACACTCGTACAGAAGTCGTGACTAAACAGCAATCTTACTTTTTTTCCCACTCTGTG
AAAGCAATATCCACAACATCCACAGCTAAAGGCATAACTTCCAAACAACTACTTATTGGCACTGTTGGTGATCAGGTTTTGGCACTTGAT
AAACGTTTCTTGGATCCTCGGCGAACACTTAACCCCACACAAGCTGAGAAAGAGGAAGGAATTATACCGCTTACCGATTCATTACCAATC
ATTCCACAGTCTTACGTGACGCATGCCCTTAAGGTGGAAGGCCTTAGAGGCATAGTAACTGTCCCTGCXGAAGTTAGAGTCAACTACTCT
CGTCTTTGCCCATGGGGGGGATCTCTTTTTTACCAAGCTTGCACCTTCGAAGACTATGATTTCTCTACTGAAGACTTCAGTTACGCTCTC
CTGCTCATTACAATTGTG
Edits in Original Sequence 
(5')GCCATTGTTGATGCATACACAGGAAAGGAGCTTAATTCTGTTGGACCTTTTCATTCGATCGTGCAAATTATTCCTCTGCCACATAC
TGATTCCAGAGAGCAGCGTTTGCATCTATTGATAGATAAGGATTGGCAtGCCCACTTATATCCCAGAAGTCCTGAGGCTCTTGCCATTTT
TCAACGCGAGGTTGGAAACATTTATTGGTATTCAGXTGGAAGCTGATAATGGTATCTTAAGGGGACATGCAGCAAAGGAGAATTGCATTT
TACAGCTGCCTGATGAATATTGTTTCGGCACGAGGAATCTGTGGTCAATTGTTTTCCCTTCAGAATCAGAAAGGATCATTGCAACTGCAA
CCAGGAAGTTGAATGAGGCAGTTCACACTCAAGCAAAAGTAGTAGCGGATCAGGATGTGATGTATAAATATATATCTAAGAATCTGCTCT
TCATTGCAACTGTTGCTCCACAAGCAGCTGGAGATATTGGATCTGTCACCCCTGATGAATCTTGGCTGGTTGTTTATCTTGTTGACACCA
TAACTGGACGTATTCTGCATCGCATGACCCATTATGGTTCACAGGGTCCTGTCCATGCAGTCGTTAGTGAGAATTGGGTTGTTTACCACT
ACTTTAACCTTAGAGCTCACAGATATGAGATGTCTGTGATCGAAATTTATGATCAGTCTCGGGCGGACAACAAGGATGTCTTGAAGTTGG
TTCTTGGGAAACATAATTTGACCTCAGCTATTTCAGCTTACACTCGTACAGAAGTCGTGACTAAACAGCAATCTTACTTTTTTTCCCACT
CTGTGAAAGCAATATCCACAACATCCACAGCTAAAGGCATAACTTCCAAACAACTACTTATTGGCACTGTTGGTGATCAGGTTTTGGCAC
TTGATAAACGTTTCTTGGATCCTCGGCGAACACTTAACCCCACACAAGCTGAGAAAGAGGAAGGAATTATACCGCTTACCGATTCATTAC
CAATCATTCCACAGTCTTACGTGACGCATGCCCTTAAGGTGGAAGGCCTTAGAGGCATAGTAACTGTCCCTGCXGAAGTTAGAGTCAACT
ACTCTCGTCTTTGCCCATGGGGGGGATCTCTTTTTTACCAAGCTTGCACCTTCGAAGACTATGATTTCTCTACTGAAGACTTCAGTTACG
CTCTCCTGCTCATTACAATTGTG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan